close

SimulationCraft 715-01

for World of Warcraft 7.1.5 Live (wow build level 23360, git build 5ef77a7)

Current simulator hotfixes

Druid

Tag Spell / Effect Field Hotfixed Value DBC Value
2016-12-18 Incorrect spell level for starfall damage component.
Starfall spell_level 40.00 76.00

Hunter

Tag Spell / Effect Field Hotfixed Value DBC Value
2017-1-8 Spelldata claims that Marking Target's rppm was buffed from 5 to 6.5, but testing shows higher.
Hunter's Mark rppm 7.20 6.50
2016-10-10 Instincts of the mongoose effect increased from 10% to 20%
(effect#1) base_value 0.00 0.00 Verification Failure (10.00)

Kil'jaeden's Burning Wish

Tag Spell / Effect Field Hotfixed Value DBC Value
2017-01-14 Damage increased by 55%.
Kil'jaeden's Burning Wish (effect#1) average 69.75 45.00

Mage

Tag Spell / Effect Field Hotfixed Value DBC Value
2017-01-11 Incorrect spell level for Frozen Orb Bolt.
Frozen Orb spell_level 57.00 81.00
2016-11-30 Reverse the incorrect AC mana cost adjustment from 60& back to 120%
Arcane Charge (effect#2) base_value 120.00 60.00

Mark of the Distant Army

Tag Spell / Effect Field Hotfixed Value DBC Value
2017-01-10 Set Velocity to a reasonable value.
Mark of the Distant Army prj_speed 40.00 1.00

Monk

Tag Spell / Effect Field Hotfixed Value DBC Value
2017-01-17 Rushing Jade Wind now applies Mark of the Crane to 4 targets (down from 5).
Rushing Jade Wind (effect#2) base_value 4.00 5.00

Paladin

Tag Spell / Effect Field Hotfixed Value DBC Value
2017-01-13 Chain of Thrayn: Damage bonus reduced from 20% to 10%.
Chain of Thrayn (effect#4) base_value 10.00 20.00
2017-01-13 Execution Sentence damage reduced by 15%.
Execution Sentence (effect#1) ap_coefficient 14.45 17.00

Shaman

Tag Spell / Effect Field Hotfixed Value DBC Value
2017-01-13 Lightning bolt overload damage increased by 9%
Lightning Bolt Overload (effect#1) sp_coefficient 1.74 1.60
2017-01-13 Lightning bolt damage increased by 9%
Lightning Bolt (effect#1) sp_coefficient 1.74 1.60

Warlock

Tag Spell / Effect Field Hotfixed Value DBC Value
2017-01-17 Demonbolt damage increased by 42%, but its damage is now increased by 10% per active demon (down from 18%).
Demonbolt (effect#3) base_value 10.00 18.00
2017-01-17 Demonbolt damage increased by 42%
Demonbolt (effect#1) sp_coefficient 1.25 0.88
2017-01-17 Shadowbolt damage increased by 42%.
Shadow Bolt (effect#1) sp_coefficient 1.25 0.88
2017-01-17 Malefic Grasp now increases the damage of damage over time effects by 70% (down from 80%).
Malefic Grasp (effect#1) base_value 70.00 80.00

Table of Contents

Raid Summary

 

Actions per Minute / DPS Variance Summary

AD+DoS : 553485 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
553485.4 553485.4 576.9 / 0.104% 79806.8 / 14.4% 19304.4
RPS Out RPS In Primary Resource Waiting APM Active Skill
28.6 28.6 Energy 21.10% 56.6 100.0% 100%
Origin https://eu.api.battle.net/wow/character/dalaran/Esdeåth/advanced
Talents
  • 15: Master of Subtlety (Subtlety Rogue)
  • 30: Subterfuge
  • 45: Deeper Stratagem
  • 90: Premeditation (Subtlety Rogue)
  • 100: Master of Shadows (Subtlety Rogue)
  • Talent Calculator
Artifact
Professions
  • alchemy: 800
  • enchanting: 133

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
AD+DoS 553485
Arcane Swipe 10614 1.9% 33.5 8.98sec 95436 0 Direct 33.5 77269 154498 95439 23.5% 0.0%  

Stats details: arcane_swipe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 33.49 33.49 0.00 0.00 0.0000 0.0000 3196000.63 3196000.63 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 25.61 76.48% 77268.55 59397 78404 77285.53 73835 78404 1978879 1978879 0.00
crit 7.88 23.52% 154498.45 118793 156807 154494.15 0 156807 1217122 1217122 0.00
 
 

Action details: arcane_swipe

Static Values
  • id:225721
  • school:arcane
  • resource:none
  • range:12.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:225721
  • name:Arcane Swipe
  • school:arcane
  • tooltip:
  • description:{$@spelldesc225127=Your melee attacks have a chance to rake all enemies in front of you for {$225721s1=18328} Arcane damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:48856.63
  • base_dd_max:48856.63
 
auto_attack_mh 10277 1.9% 126.2 1.96sec 24731 15997 Direct 126.2 23640 47290 24731 23.6% 19.0%  

Stats details: auto_attack_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 126.23 126.23 0.00 0.00 1.5460 0.0000 3121885.26 4589467.05 31.98 15997.03 15997.03
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 72.50 57.43% 23640.12 18265 24110 23646.56 22853 24013 1713886 2519575 31.98
crit 29.77 23.59% 47289.56 36530 48220 47299.32 45298 48220 1407999 2069892 31.98
miss 23.96 18.98% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_mh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
auto_attack_oh 5094 0.9% 125.4 1.97sec 12344 7927 Direct 125.4 11818 23637 12344 23.5% 19.1%  

Stats details: auto_attack_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 125.37 125.37 0.00 0.00 1.5572 0.0000 1547575.35 2275082.35 31.98 7927.46 7927.46
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 71.99 57.43% 11817.57 9133 12055 11820.59 11535 12008 850774 1250718 31.98
crit 29.48 23.51% 23636.50 18265 24110 23644.42 22831 24110 696802 1024365 31.98
miss 23.89 19.06% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_oh

Static Values
  • id:1
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Backstab 28166 5.1% 52.9 5.39sec 160868 160149 Direct 52.9 129986 259968 160866 23.8% 0.0%  

Stats details: backstab

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 52.93 52.93 0.00 0.00 1.0045 0.0000 8514664.62 12517363.52 31.98 160149.43 160149.43
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 40.35 76.24% 129986.12 101005 133327 130019.10 125246 132970 5245496 7711376 31.98
crit 12.58 23.76% 259967.91 202010 266653 260048.00 246452 266653 3269169 4805987 31.98
 
 

Action details: backstab

Static Values
  • id:53
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:53
  • name:Backstab
  • school:physical
  • tooltip:
  • description:Stab the target, causing ${$sw2*$<mult>} Physical damage. Damage increased by {$s4=30}% when you are behind your target. |cFFFFFFFFAwards {$s3=1} combo $lpoint:points;.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.70
 
Collapse 1623 0.3% 5.8 43.84sec 82476 0 Direct 5.8 66457 132947 82471 24.1% 0.0%  

Stats details: collapse

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.85 5.85 0.00 0.00 0.0000 0.0000 482365.22 482365.22 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.44 75.91% 66456.51 50574 66758 66131.11 0 66758 295033 295033 0.00
crit 1.41 24.09% 132946.59 101148 133516 100007.58 0 133516 187332 187332 0.00
 
 

Action details: collapse

Static Values
  • id:234142
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:15.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:234142
  • name:Collapse
  • school:shadow
  • tooltip:
  • description:Deal {$s1=40000} Shadow damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:40000.00
  • base_dd_max:40000.00
 
Eviscerate 155809 28.1% 52.4 5.66sec 892157 888176 Direct 52.4 643529 1287773 892117 38.6% 0.0%  

Stats details: eviscerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 52.37 52.37 0.00 0.00 1.0045 0.0000 46718944.00 68681273.01 31.98 888175.97 888175.97
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 32.16 61.41% 643529.34 401033 787693 643883.24 595380 696890 20693472 30421364 31.98
crit 20.21 38.59% 1287773.23 802066 1575386 1288399.49 1100434 1431142 26025472 38259909 31.98
 
 

Action details: eviscerate

Static Values
  • id:196819
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.15
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:196819
  • name:Eviscerate
  • school:physical
  • tooltip:
  • description:Finishing move that disembowels the target, causing damage per combo point. 1 point : ${$m1*1} damage 2 points: ${$m1*2} damage 3 points: ${$m1*3} damage 4 points: ${$m1*4} damage 5 points: ${$m1*5} damage{$?s193531=false}[ 6 points: ${$m1*6} damage][]
Weapon
  • normalized:false
  • weapon_power_mod:0.000000
  • weapon_multiplier:0.00
 
Fel-Crazed Rage 36414 6.6% 35.8 8.12sec 305455 0 Direct 35.8 246982 493969 305518 23.7% 0.0%  

Stats details: felcrazed_rage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 35.82 35.81 0.00 0.00 0.0000 0.0000 10940848.24 10940848.24 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 27.32 76.30% 246982.06 188967 249436 247129.09 222835 249436 6748293 6748293 0.00
crit 8.49 23.70% 493969.24 377933 498872 494266.54 402121 498872 4192556 4192556 0.00
 
 

Action details: felcrazed_rage

Static Values
  • id:225777
  • school:shadow
  • resource:none
  • range:8.0
  • travel_speed:30.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:225777
  • name:Fel-Crazed Rage
  • school:shadow
  • tooltip:
  • description:{$@spelldesc225141=Enter a fel-crazed rage, dealing {$225777s1=53264 to 58870} Shadow damage to a random nearby enemy every ${$t1}.2 sec for {$d=3 seconds}. You cannot move or use abilities during your rage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:141984.15
  • base_dd_max:156929.85
 
Goremaw's Bite 0 (9419) 0.0% (1.7%) 4.6 63.53sec 610859 608126

Stats details: goremaws_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.64 0.00 0.00 0.00 1.0045 0.0000 0.00 0.00 0.00 608126.49 608126.49
 
 

Action details: goremaws_bite

Static Values
  • id:209782
  • school:shadow
  • resource:none
  • range:8.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!stealthed.all&cooldown.shadow_dance.charges_fractional<=2.45&((combo_points.deficit>=4-(time<10)*2&energy.deficit>50+talent.vigor.enabled*25-(time>=10)*15)|target.time_to_die<8)
Spelldata
  • id:209782
  • name:Goremaw's Bite
  • school:physical
  • tooltip:
  • description:Lashes out at the target, inflicting ${$209783sw2+$209784sw2} Shadow damage and reducing movement speed by {$209786s1=60}% for {$209786d=8 seconds}. Grants $220901o2 Energy over {$220901d=6 seconds}. |cFFFFFFFFAwards {$220901s1=3} combo $lpoint:points;.|r
 
    Goremaw's Bite (_mh) 6288 1.1% 4.6 63.53sec 407784 0 Direct 4.6 329005 658036 407755 23.9% 0.0%  

Stats details: goremaws_bite_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.64 4.64 0.00 0.00 0.0000 0.0000 1893799.87 1893799.87 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 3.53 76.06% 329005.49 257468 339858 328085.53 0 339858 1162157 1162157 0.00
crit 1.11 23.94% 658035.90 514937 679717 466584.93 0 679717 731643 731643 0.00
 
 

Action details: goremaws_bite_mh

Static Values
  • id:209783
  • school:shadow
  • resource:none
  • range:8.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:209783
  • name:Goremaw's Bite
  • school:shadow
  • tooltip:
  • description:{$@spelldesc209782=Lashes out at the target, inflicting ${$209783sw2+$209784sw2} Shadow damage and reducing movement speed by {$209786s1=60}% for {$209786d=8 seconds}. Grants $220901o2 Energy over {$220901d=6 seconds}. |cFFFFFFFFAwards {$220901s1=3} combo $lpoint:points;.|r}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:10.00
 
    Goremaw's Bite (_oh) 3131 0.6% 4.6 63.53sec 203076 0 Direct 4.6 164534 328881 203091 23.4% 0.0%  

Stats details: goremaws_bite_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.64 4.64 0.00 0.00 0.0000 0.0000 943110.23 943110.23 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 3.56 76.55% 164534.26 128741 169938 164265.35 0 169938 584943 584943 0.00
crit 1.09 23.45% 328881.47 257481 339875 231158.16 0 339875 358167 358167 0.00
 
 

Action details: goremaws_bite_oh

Static Values
  • id:209784
  • school:shadow
  • resource:none
  • range:8.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:209784
  • name:Goremaw's Bite
  • school:shadow
  • tooltip:
  • description:{$@spelldesc209782=Lashes out at the target, inflicting ${$209783sw2+$209784sw2} Shadow damage and reducing movement speed by {$209786s1=60}% for {$209786d=8 seconds}. Grants $220901o2 Energy over {$220901d=6 seconds}. |cFFFFFFFFAwards {$220901s1=3} combo $lpoint:points;.|r}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:10.00
 
Mark of the Hidden Satyr 8347 1.5% 16.8 17.49sec 149689 0 Direct 16.8 121029 242044 149699 23.7% 0.0%  

Stats details: mark_of_the_hidden_satyr

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.77 16.77 0.00 0.00 0.0000 0.0000 2509706.67 2509706.67 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 12.80 76.32% 121028.88 93052 122828 121047.67 113523 122828 1548608 1548608 0.00
crit 3.97 23.68% 242043.64 186103 245656 237961.65 0 245656 961098 961098 0.00
 
 

Action details: mark_of_the_hidden_satyr

Static Values
  • id:191259
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191259
  • name:Mark of the Hidden Satyr
  • school:fire
  • tooltip:
  • description:Deals fire damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:2.500000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Nightblade 109426 19.8% 16.9 17.49sec 1945244 1936649 Periodic 143.2 186184 372484 230146 23.6% 0.0% 95.1%

Stats details: nightblade

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.95 0.00 143.24 143.24 1.0045 2.0000 32965647.03 32965647.03 0.00 108618.99 1936649.46
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 109.4 76.40% 186184.40 127142 208112 186218.94 181295 192167 20375516 20375516 0.00
crit 33.8 23.60% 372483.82 254285 416223 372580.59 341599 398095 12590131 12590131 0.00
 
 

Action details: nightblade

Static Values
  • id:195452
  • school:shadow
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:25.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:target.time_to_die>8&((refreshable&(!finality|buff.finality_nightblade.up))|remains<tick_time)
Spelldata
  • id:195452
  • name:Nightblade
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec and snared by attacks.
  • description:Finishing move that infects the target with shadowy energy, dealing Shadow damage over time and causing attacks against the target to reduce movement speed by {$206760s1=30}% for {$206760d=8 seconds}. Lasts longer per combo point. 1 point : ${$m1*8/2} over 8 sec 2 points: ${$m1*10/2} over 10 sec 3 points: ${$m1*12/2} over 12 sec 4 points: ${$m1*14/2} over 14 sec 5 points: ${$m1*16/2} over 16 sec{$?s193531=false}[ 6 points: ${$m1*18/2} over 18 sec][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:1.380000
  • spell_power_mod.tick:0.000000
  • base_td:1.00
  • dot_duration:6.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Potion of the Old War 17599 3.1% 22.0 9.52sec 236348 0 Direct 22.0 190916 381818 236337 23.8% 0.0%  

Stats details: potion_of_the_old_war

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.01 22.01 0.00 0.00 0.0000 0.0000 5201651.24 7646920.03 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.77 76.20% 190916.47 146122 192882 190910.62 179413 192882 3201819 4706977 31.98
crit 5.24 23.80% 381818.34 292245 385763 380628.69 0 385763 1999832 2939943 31.88
 
 

Action details: potion_of_the_old_war

Static Values
  • id:188028
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188028
  • name:Potion of the Old War
  • school:physical
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:135920.00
  • base_dd_max:203880.00
 
Shadow Blades 0 (14042) 0.0% (2.5%) 2.1 180.26sec 1983050 0

Stats details: shadow_blades

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.10 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: shadow_blades

Static Values
  • id:121471
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:combo_points<=2|(equipped.denial_of_the_halfgiants&combo_points>=1)
Spelldata
  • id:121471
  • name:Shadow Blades
  • school:physical
  • tooltip:Autoattacks deal pure Shadow damage. Combo-point-generating attacks generate {$s2=1} additional combo point.
  • description:Draws upon surrounding shadows to empower your weapons, causing auto attacks to deal Shadow damage and abilities that generate combo points to generate 1 additional combo point. Lasts {$d=15 seconds}.
 
    Shadow Blade (_mh) 9362 1.7% 63.7 3.70sec 43460 31090 Direct 63.7 35160 70324 43460 23.6% 0.0%  

Stats details: shadow_blade_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 63.75 63.75 0.00 0.00 1.3979 0.0000 2770452.75 2770452.75 0.00 31090.26 31090.26
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 48.70 76.40% 35159.65 26852 35444 35158.07 34175 35444 1712285 1712285 0.00
crit 15.05 23.60% 70324.07 53703 70888 70317.97 63728 70888 1058168 1058168 0.00
 
 

Action details: shadow_blade_mh

Static Values
  • id:121473
  • school:shadow
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:121473
  • name:Shadow Blade
  • school:shadow
  • tooltip:
  • description:Strike with dark energy, dealing Shadow damage equal to {$s1=1}% weapon damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
    Shadow Blade Off-hand 4680 0.8% 63.7 3.70sec 21731 15546 Direct 63.7 17580 35163 21731 23.6% 0.0%  

Stats details: shadow_blade_offhand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 63.75 63.75 0.00 0.00 1.3979 0.0000 1385265.05 1385265.05 0.00 15545.56 15545.56
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 48.70 76.39% 17579.68 13426 17722 17578.75 17016 17722 856104 856104 0.00
crit 15.05 23.61% 35162.97 26852 35444 35162.09 32893 35444 529161 529161 0.00
 
 

Action details: shadow_blade_offhand

Static Values
  • id:121474
  • school:shadow
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:121474
  • name:Shadow Blade Off-hand
  • school:shadow
  • tooltip:
  • description:Strike with dark energy, dealing Shadow damage equal to {$s1=1}% weapon damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Shadow Nova 9953 1.8% 31.5 9.56sec 94774 0 Direct 31.5 76641 153281 94776 23.7% 0.0%  

Stats details: shadow_nova

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 31.54 31.54 0.00 0.00 0.0000 0.0000 2988724.45 2988724.45 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 24.07 76.34% 76640.63 63871 76645 76640.66 75846 76645 1845048 1845048 0.00
crit 7.46 23.66% 153281.33 127741 153290 153250.54 0 153290 1143677 1143677 0.00
 
 

Action details: shadow_nova

Static Values
  • id:197800
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:5.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:197800
  • name:Shadow Nova
  • school:shadow
  • tooltip:
  • description:Deals {$s1=0} Shadow damage to enemies with $A1 yards.
 
Shadowstrike 111433 (136703) 20.1% (24.7%) 101.5 2.92sec 404162 402354 Direct 101.5 246291 492596 329446 33.8% 0.0%  

Stats details: shadowstrike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 101.51 101.51 0.00 0.00 1.0045 0.0000 33442665.82 49163886.53 31.98 402354.43 402354.43
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 67.24 66.24% 246291.38 205255 246306 246291.56 244303 246306 16561284 24346657 31.98
crit 34.27 33.76% 492595.77 410510 492612 492595.94 489042 492612 16881382 24817230 31.98
 
 

Action details: shadowstrike

Static Values
  • id:185438
  • school:physical
  • resource:energy
  • range:15.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:185438
  • name:Shadowstrike
  • school:physical
  • tooltip:
  • description:Strike through the shadows, $?a231718[appearing behind your target and ][]dealing $sw2 Physical damage. |cFFFFFFFFAwards {$s3=1} combo $lpoint:points;.|r
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:8.50
 
    Soul Rip 25269 4.6% 100.9 2.92sec 75152 0 Direct 100.9 60831 121661 75152 23.5% 0.0%  

Stats details: soul_rip

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 100.93 100.93 0.00 0.00 0.0000 0.0000 7585013.14 7585013.14 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 77.17 76.46% 60830.51 60831 60831 60830.51 60831 60831 4694037 4694037 0.00
crit 23.76 23.54% 121661.02 121661 121661 121661.02 121661 121661 2890976 2890976 0.00
 
 

Action details: soul_rip

Static Values
  • id:220893
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:220893
  • name:Soul Rip
  • school:shadow
  • tooltip:
  • description:{$@spelldesc209835=After using Shadowstrike or Cheap Shot, Akaari's Soul appears $m1 sec later and Soul Rips your target, dealing {$220893s1=1} Shadow damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:1.500000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Simple Action Stats Execute Interval
AD+DoS
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:AD+DoS
  • harmful:false
  • if_expr:
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:AD+DoS
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:AD+DoS
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Shadow Dance 25.8 11.58sec

Stats details: shadow_dance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 25.83 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: shadow_dance

Static Values
  • id:185313
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:charges_fractional>=2.45
Spelldata
  • id:185313
  • name:Shadow Dance
  • school:physical
  • tooltip:
  • description:Allows use of all Stealth abilities and grants all the combat benefits of Stealth for {$d=3 seconds}. Effect not broken from taking damage or attacking. {$?s14062=false}[Movement speed while active is increased by {$1784s3=0}% and damage dealt is increased by {$1784s4=0}%. ]?s108209[Abilities cost {$112942s1=75}% less while active. ][]{$?s31223=false}[Attacks from Shadow Dance and for {$31223s1=5} sec after deal {$31665s1=10}% more damage. ][]
 
Sprint 2.7 122.25sec

Stats details: sprint

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.71 0.00 85.78 0.00 0.0000 0.2500 0.00 0.00 0.00 0.00 0.00
 
 

Action details: sprint

Static Values
  • id:2983
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:2983
  • name:Sprint
  • school:physical
  • tooltip:Movement speed increased by $w1%.
  • description:Increases your movement speed by {$s1=70}% for {$d=8 seconds}. Usable while stealthed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:0.25
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Symbols of Death 13.6 23.34sec

Stats details: symbols_of_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.58 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: symbols_of_death

Static Values
  • id:212283
  • school:physical
  • resource:energy
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:10.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:212283
  • name:Symbols of Death
  • school:physical
  • tooltip:All damage done increased by {$s1=20}%.
  • description:Invoke ancient symbols of power, increasing all damage you deal by {$s1=20}% for {$d=35 seconds}, and causing your next Shadowstrike to critically strike. Unaffected by the global cooldown.
 
Vanish 2.8 122.21sec

Stats details: vanish

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.81 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: vanish

Static Values
  • id:1856
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:1856
  • name:Vanish
  • school:physical
  • tooltip:Improved stealth.
  • description:Allows you to vanish from sight, entering stealth while in combat. For the first {$11327d=3 seconds} after vanishing, damage and harmful effects received will not break stealth. Also breaks movement impairing effects.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 33.34% 0.0(0.0) 1.0

Buff details

  • buff initial source:AD+DoS
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Death 13.6 0.0 22.4sec 23.3sec 2.42% 13.20% 0.0(0.0) 0.2

Buff details

  • buff initial source:AD+DoS
  • cooldown name:buff_death
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • death_1:2.42%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:227151
  • name:Death
  • tooltip:Your next Shadowstrike will critically strike.
  • description:{$@spelldesc212283=Invoke ancient symbols of power, increasing all damage you deal by {$s1=20}% for {$d=35 seconds}, and causing your next Shadowstrike to critically strike. Unaffected by the global cooldown.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Faster Than Light Trigger 2.7 0.0 122.3sec 122.3sec 2.69% 2.69% 0.0(0.0) 2.7

Buff details

  • buff initial source:AD+DoS
  • cooldown name:buff_faster_than_light_trigger
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • faster_than_light_trigger_1:2.69%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:197270
  • name:Faster Than Light Trigger
  • tooltip:
  • description:
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
Finality: Eviscerate 26.4 0.0 11.3sec 11.3sec 48.32% 49.51% 0.0(0.0) 0.0

Buff details

  • buff initial source:AD+DoS
  • cooldown name:buff_finality_eviscerate
  • max_stacks:10
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.04

Stack Uptimes

  • finality_eviscerate_5:23.08%
  • finality_eviscerate_6:25.24%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:197496
  • name:Finality: Eviscerate
  • tooltip:Your next Eviscerate will do $w1% increased damage.
  • description:
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Finality: Nightblade 8.7 0.0 35.1sec 35.1sec 42.96% 40.94% 0.0(0.0) 0.0

Buff details

  • buff initial source:AD+DoS
  • cooldown name:buff_finality_nightblade
  • max_stacks:6
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.04

Stack Uptimes

  • finality_nightblade_5:17.57%
  • finality_nightblade_6:25.38%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:197498
  • name:Finality: Nightblade
  • tooltip:Your next Nightblade will do $w1% increased damage.
  • description:
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Goremaw's Bite 4.6 0.0 63.6sec 63.6sec 9.13% 9.13% 27.5(27.5) 4.5

Buff details

  • buff initial source:AD+DoS
  • cooldown name:buff_goremaws_bite
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • goremaws_bite_1:9.13%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:220901
  • name:Goremaw's Bite
  • tooltip:Generating {$s2=5} Energy every $t2 sec.
  • description:{$@spelldesc209782=Lashes out at the target, inflicting ${$209783sw2+$209784sw2} Shadow damage and reducing movement speed by {$209786s1=60}% for {$209786d=8 seconds}. Grants $220901o2 Energy over {$220901d=6 seconds}. |cFFFFFFFFAwards {$220901s1=3} combo $lpoint:points;.|r}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Master of Subtlety 36.4 1.4 8.3sec 7.9sec 34.41% 45.62% 1.4(1.4) 12.8

Buff details

  • buff initial source:AD+DoS
  • cooldown name:buff_master_of_subtlety
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • master_of_subtlety_1:34.41%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:31223
  • name:Master of Subtlety
  • tooltip:
  • description:Attacks made while stealthed and for {$s1=5} seconds after breaking stealth cause an additional {$31665s1=10}% damage.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Master of Subtlety (_aura) 36.4 1.4 8.3sec 8.1sec 48.70% 36.68% 1.4(1.4) 0.0

Buff details

  • buff initial source:AD+DoS
  • cooldown name:buff_master_of_subtlety_aura
  • max_stacks:1
  • duration:150.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • master_of_subtlety_aura_1:48.70%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:31223
  • name:Master of Subtlety
  • tooltip:
  • description:Attacks made while stealthed and for {$s1=5} seconds after breaking stealth cause an additional {$31665s1=10}% damage.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of the Old War 2.0 0.0 180.0sec 0.0sec 16.24% 16.24% 0.0(0.0) 2.0

Buff details

  • buff initial source:AD+DoS
  • cooldown name:buff_potion_of_the_old_war
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_the_old_war_1:16.24%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188028
  • name:Potion of the Old War
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Shadow Blades 2.1 0.0 180.2sec 180.3sec 33.00% 36.68% 0.0(0.0) 2.0

Buff details

  • buff initial source:AD+DoS
  • cooldown name:buff_shadow_blades
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • shadow_blades_1:33.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:121471
  • name:Shadow Blades
  • tooltip:Autoattacks deal pure Shadow damage. Combo-point-generating attacks generate {$s2=1} additional combo point.
  • description:Draws upon surrounding shadows to empower your weapons, causing auto attacks to deal Shadow damage and abilities that generate combo points to generate 1 additional combo point. Lasts {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Shadow Dance 25.8 0.0 11.6sec 11.6sec 42.70% 42.70% 0.0(0.0) 25.5

Buff details

  • buff initial source:AD+DoS
  • cooldown name:buff_shadow_dance
  • max_stacks:1
  • duration:5.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • shadow_dance_1:42.70%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:185313
  • name:Shadow Dance
  • tooltip:
  • description:Allows use of all Stealth abilities and grants all the combat benefits of Stealth for {$d=3 seconds}. Effect not broken from taking damage or attacking. {$?s14062=false}[Movement speed while active is increased by {$1784s3=0}% and damage dealt is increased by {$1784s4=0}%. ]?s108209[Abilities cost {$112942s1=75}% less while active. ][]{$?s31223=false}[Attacks from Shadow Dance and for {$31223s1=5} sec after deal {$31665s1=10}% more damage. ][]
  • max_stacks:0
  • duration:3.00
  • cooldown:1.00
  • default_chance:0.00%
Sprint 2.7 0.0 122.3sec 122.3sec 7.11% 7.11% 85.8(85.8) 2.7

Buff details

  • buff initial source:AD+DoS
  • cooldown name:buff_sprint
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • sprint_1:7.11%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2983
  • name:Sprint
  • tooltip:Movement speed increased by $w1%.
  • description:Increases your movement speed by {$s1=70}% for {$d=8 seconds}. Usable while stealthed.
  • max_stacks:0
  • duration:8.00
  • cooldown:120.00
  • default_chance:0.00%
Stealth 6.4 0.0 45.4sec 51.8sec 2.04% 2.04% 0.0(0.0) 0.0

Buff details

  • buff initial source:AD+DoS
  • cooldown name:buff_stealth
  • max_stacks:1
  • duration:150.00
  • cooldown:2.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stealth_1:2.04%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:1784
  • name:Stealth
  • tooltip:Stealthed.$?$w3!=0[ Movement speed increased by $w3%.][]$?$w4!=0[ Damage increased by $w4%.][]
  • description:Conceals you in the shadows until cancelled, allowing you to stalk enemies without being seen. {$?s14062=false}[Movement speed while stealthed is increased by {$s3=0}% and damage dealt is increased by {$s4=0}%.]?s108209[ Abilities cost {$112942s1=75}% less while stealthed. ][]{$?s31223=false}[ Attacks from Stealth and for {$31223s1=5} sec after deal {$31665s1=10}% more damage.][]
  • max_stacks:0
  • duration:-0.00
  • cooldown:2.00
  • default_chance:100.00%
Subterfuge 6.5 0.0 44.5sec 44.5sec 6.47% 6.47% 0.0(0.0) 6.4

Buff details

  • buff initial source:AD+DoS
  • cooldown name:buff_subterfuge
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • subterfuge_1:6.47%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:115192
  • name:Subterfuge
  • tooltip:Temporarily concealed in the shadows.
  • description:{$@spelldesc108208=Your abilities requiring Stealth can still be used for {$115192d=3 seconds} after Stealth breaks.$?c3[ Also increases the duration of Shadow Dance by ${$m2/1000} sec.][ Also causes Garrote to deal {$115192s2=125}% increased damage and have no cooldown when used from Stealth or {$115192d=3 seconds} after Stealth breaks.]}
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
Symbols of Death 1.2 12.4 196.3sec 23.3sec 99.78% 99.30% 12.4(12.4) 0.3

Buff details

  • buff initial source:AD+DoS
  • cooldown name:buff_symbols_of_death
  • max_stacks:1
  • duration:35.00
  • cooldown:10.00
  • default_chance:100.00%
  • default_value:1.20

Stack Uptimes

  • symbols_of_death_1:99.78%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:212283
  • name:Symbols of Death
  • tooltip:All damage done increased by {$s1=20}%.
  • description:Invoke ancient symbols of power, increasing all damage you deal by {$s1=20}% for {$d=35 seconds}, and causing your next Shadowstrike to critically strike. Unaffected by the global cooldown.
  • max_stacks:0
  • duration:35.00
  • cooldown:10.00
  • default_chance:0.00%
Temptation 1.9 4.0 175.9sec 44.1sec 36.86% 66.68% 0.0(0.0) 1.4

Buff details

  • buff initial source:AD+DoS
  • cooldown name:buff_temptation
  • max_stacks:10
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • temptation_1:9.81%
  • temptation_2:9.97%
  • temptation_3:9.76%
  • temptation_4:7.24%
  • temptation_5:0.14%
  • temptation_6:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:234143
  • name:Temptation
  • tooltip:Increased chance for your Ring of Collapsing Futures to incur a {$s1=5} min cooldown.
  • description:{$@spelldesc234142=Deal {$s1=40000} Shadow damage to an enemy.}
  • max_stacks:10
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Vanish 5.5 0.0 51.7sec 51.7sec 5.45% 5.45% 0.0(0.0) 5.4

Buff details

  • buff initial source:AD+DoS
  • cooldown name:buff_vanish
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • vanish_1:5.45%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:11327
  • name:Vanish
  • tooltip:Improved stealth.$?$w3!=0[ Movement speed increased by $w3%.][]$?$w4!=0[ Damage increased by $w4%.][]
  • description:
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:AD+DoS
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Seventh Demon

Buff details

  • buff initial source:AD+DoS
  • cooldown name:buff_flask_of_the_seventh_demon
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:1300.00

Stack Uptimes

  • flask_of_the_seventh_demon_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188033
  • name:Flask of the Seventh Demon
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (seedbattered_fish_plate)

Buff details

  • buff initial source:AD+DoS
  • cooldown name:buff_seedbattered_fish_plate
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:versatility_rating
  • amount:375.00

Stack Uptimes

  • seedbattered_fish_plate_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225605
  • name:Well Fed
  • tooltip:Versatility increased by $w1.
  • description:Increases versatility by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
AD+DoS
backstab Energy 52.9 1852.5 35.0 35.0 4596.3
eviscerate Energy 52.4 1832.8 35.0 35.0 25490.6
eviscerate Combo Points 52.4 290.7 5.6 5.6 160691.7
nightblade Energy 16.9 423.7 25.0 25.0 77810.5
nightblade Combo Points 16.9 94.1 5.6 5.6 350221.8
shadowstrike Energy 101.5 4060.5 40.0 40.0 10104.1
symbols_of_death Energy 13.6 440.4 32.4 32.4 0.0
Resource Gains Type Count Total Average Overflow
backstab Combo Points 52.93 52.93 (13.65%) 1.00 0.00 0.00%
goremaws_bite Combo Points 4.64 13.76 (3.55%) 2.96 0.17 1.21%
shadowstrike Combo Points 101.51 203.02 (52.37%) 2.00 0.00 0.00%
energy_regen Energy 1166.17 3376.74 (39.49%) 2.90 156.00 4.42%
Shadow Techniques Combo Points 73.23 73.33 (18.91%) 1.00 14.62 16.62%
Master of Shadows Energy 36.79 771.93 (9.03%) 20.98 147.77 16.07%
Shadow Blades Combo Points 53.53 44.63 (11.51%) 0.83 8.89 16.62%
Energetic Stabbing Energy 25.36 634.11 (7.42%) 25.00 0.00 0.00%
Goremaw's Bite Energy 27.47 132.02 (1.54%) 4.81 5.32 3.88%
Relentless Strikes Energy 69.31 3027.23 (35.40%) 43.68 51.18 1.66%
Shadow Satyr's Walk Energy 101.51 609.07 (7.12%) 6.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Energy 28.38 28.58
Combo Points 1.29 1.28
Combat End Resource Mean Min Max
Energy 40.89 6.37 100.00
Combo Points 2.78 0.00 6.00

Benefits & Uptimes

Benefits %
Uptimes %
Energy Cap 3.0%

Statistics & Data Analysis

Fight Length
Sample Data AD+DoS Fight Length
Count 4999
Mean 301.28
Minimum 222.03
Maximum 381.32
Spread ( max - min ) 159.29
Range [ ( max - min ) / 2 * 100% ] 26.44%
DPS
Sample Data AD+DoS Damage Per Second
Count 4999
Mean 553485.43
Minimum 495276.53
Maximum 642744.31
Spread ( max - min ) 147467.78
Range [ ( max - min ) / 2 * 100% ] 13.32%
Standard Deviation 20812.4860
5th Percentile 519728.89
95th Percentile 587448.02
( 95th Percentile - 5th Percentile ) 67719.13
Mean Distribution
Standard Deviation 294.3624
95.00% Confidence Intervall ( 552908.49 - 554062.37 )
Normalized 95.00% Confidence Intervall ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 55
0.1% Error 5432
0.1 Scale Factor Error with Delta=300 3697700
0.05 Scale Factor Error with Delta=300 14790798
0.01 Scale Factor Error with Delta=300 369769928
Priority Target DPS
Sample Data AD+DoS Priority Target Damage Per Second
Count 4999
Mean 553485.43
Minimum 495276.53
Maximum 642744.31
Spread ( max - min ) 147467.78
Range [ ( max - min ) / 2 * 100% ] 13.32%
Standard Deviation 20812.4860
5th Percentile 519728.89
95th Percentile 587448.02
( 95th Percentile - 5th Percentile ) 67719.13
Mean Distribution
Standard Deviation 294.3624
95.00% Confidence Intervall ( 552908.49 - 554062.37 )
Normalized 95.00% Confidence Intervall ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 55
0.1% Error 5432
0.1 Scale Factor Error with Delta=300 3697700
0.05 Scale Factor Error with Delta=300 14790798
0.01 Scale Factor Error with Delta=300 369769928
DPS(e)
Sample Data AD+DoS Damage Per Second (Effective)
Count 4999
Mean 553485.43
Minimum 495276.53
Maximum 642744.31
Spread ( max - min ) 147467.78
Range [ ( max - min ) / 2 * 100% ] 13.32%
Damage
Sample Data AD+DoS Damage
Count 4999
Mean 166208319.55
Minimum 122414785.84
Maximum 210149733.17
Spread ( max - min ) 87734947.32
Range [ ( max - min ) / 2 * 100% ] 26.39%
DTPS
Sample Data AD+DoS Damage Taken Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data AD+DoS Healing Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data AD+DoS Healing Per Second (Effective)
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data AD+DoS Heal
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data AD+DoS Healing Taken Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data AD+DoS Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data AD+DoSTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data AD+DoS Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,name=flask_of_the_seventh_demon
1 0.00 augmentation,name=defiled
2 0.00 food,name=seedbattered_fish_plate
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 stealth
5 0.00 potion,name=old_war
6 0.00 marked_for_death,if=raid_event.adds.in>40
7 0.00 variable,name=ssw_refund,value=equipped.shadow_satyrs_walk*(4+ssw_refund_offset)
Defined variables that doesn't change during the fight
8 0.00 variable,name=stealth_threshold,value=(15+talent.vigor.enabled*35+talent.master_of_shadows.enabled*30+variable.ssw_refund)
9 0.00 enveloping_shadows,if=combo_points>=5
A 0.00 symbols_of_death
Default action list Executed every time the actor is available.
# count action,conditions
B 0.00 call_action_list,name=cds
C 0.00 run_action_list,name=stealthed,if=stealthed.all
Fully switch to the Stealthed Rotation (by doing so, it forces pooling if nothing is available)
D 0.00 call_action_list,name=finish,if=combo_points>=5|(combo_points>=4&spell_targets.shuriken_storm>=3&spell_targets.shuriken_storm<=4)
E 0.00 call_action_list,name=stealth_als,if=combo_points.deficit>=2+talent.premeditation.enabled
F 0.00 call_action_list,name=build,if=energy.deficit<=variable.stealth_threshold
actions.build Builders
# count action,conditions
0.00 shuriken_storm,if=spell_targets.shuriken_storm>=2
0.00 gloomblade
G 52.93 backstab
actions.cds Cooldowns
# count action,conditions
H 1.00 potion,name=old_war,if=buff.bloodlust.react|target.time_to_die<=25|buff.shadow_blades.up
I 5.85 use_item,slot=finger2,if=(buff.shadow_blades.up&stealthed.rogue)|target.time_to_die<20
J 2.77 use_item,slot=trinket2,if=(buff.shadow_blades.up&stealthed.rogue)|target.time_to_die<20
0.00 blood_fury,if=stealthed.rogue
0.00 berserking,if=stealthed.rogue
0.00 arcane_torrent,if=stealthed.rogue&energy.deficit>70
K 2.10 shadow_blades,if=combo_points<=2|(equipped.denial_of_the_halfgiants&combo_points>=1)
L 4.65 goremaws_bite,if=!stealthed.all&cooldown.shadow_dance.charges_fractional<=2.45&((combo_points.deficit>=4-(time<10)*2&energy.deficit>50+talent.vigor.enabled*25-(time>=10)*15)|target.time_to_die<8)
0.00 marked_for_death,target_if=min:target.time_to_die,if=target.time_to_die<combo_points.deficit|(raid_event.adds.in>40&combo_points.deficit>=4+talent.deeper_strategem.enabled+talent.anticipation.enabled)
actions.finish Finishers
# count action,conditions
0.00 enveloping_shadows,if=buff.enveloping_shadows.remains<target.time_to_die&buff.enveloping_shadows.remains<=combo_points*1.8
0.00 death_from_above,if=spell_targets.death_from_above>=6
M 16.95 nightblade,cycle_targets=1,if=target.time_to_die>8&((refreshable&(!finality|buff.finality_nightblade.up))|remains<tick_time)
0.00 death_from_above
N 52.37 eviscerate
actions.stealth_cds Stealth Cooldowns
# count action,conditions
S 3.84 shadow_dance,if=charges_fractional>=2.45
T 2.81 vanish
U 2.71 sprint_offensive
V 4.23 shadow_dance,if=charges>=2&combo_points<=1
0.00 pool_resource,for_next=1,extra_amount=40
0.00 shadowmeld,if=energy>=40&energy.deficit>=10+variable.ssw_refund
W 17.75 shadow_dance,if=combo_points<=1
actions.stealthed Stealthed Rotation
# count action,conditions
X 12.58 symbols_of_death,if=(buff.symbols_of_death.remains<target.time_to_die-4&buff.symbols_of_death.remains<=buff.symbols_of_death.duration*0.3)|equipped.shadow_satyrs_walk&energy.time_to_max<0.25
Y 0.00 call_action_list,name=finish,if=combo_points>=5
0.00 shuriken_storm,if=buff.shadowmeld.down&((combo_points.deficit>=3&spell_targets.shuriken_storm>=2+talent.premeditation.enabled+equipped.shadow_satyrs_walk)|buff.the_dreadlords_deceit.stack>=29)
Z 101.51 shadowstrike

Sample Sequence

0124578AKIJZZMSZZNZZNGGNSIXZZMZZNLGNSXZZNZZNGGNSIZXZNZZMTZZNSZZNZZNUVZZNXZZMGVZZNZZGNVZZNZGNWZZMZZNWZZNXZZMLGNWZZZNZNGWZZNZZMGGGNWZZZMZGNGGGNWXZZNGGGMLGNWXZZNZZGMGTZNZGNWXZZNZZGNUWZZZNXZZKHGMWJZZNGGNGGMWZZNZGNGGNLGNWXZZMZZNWZZNZZNGGGMWZZZNGGGNGGMWXZZNZGGMGGNLJGNWXZZNZTZZNWZZNZZ

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask AD+DoS 100.0/100: 100% energy | 0.0/6: 0% combo_points
Pre precombat 1 augmentation AD+DoS 100.0/100: 100% energy | 0.0/6: 0% combo_points
Pre precombat 2 food AD+DoS 100.0/100: 100% energy | 0.0/6: 0% combo_points
Pre precombat 4 stealth Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, stealth
Pre precombat 5 potion Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, stealth, potion_of_the_old_war
Pre precombat 7 ssw_refund Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, stealth, potion_of_the_old_war
Pre precombat 8 stealth_threshold Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, stealth, potion_of_the_old_war
Pre precombat A symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, stealth, symbols_of_death, death, potion_of_the_old_war
0:00.000 cds K shadow_blades Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, stealth, symbols_of_death, death, potion_of_the_old_war
0:00.000 cds I use_item_ring_of_collapsing_futures Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, stealth, symbols_of_death, shadow_blades, death, potion_of_the_old_war
0:00.000 cds J use_item_draught_of_souls Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points temptation, master_of_subtlety_aura, stealth, symbols_of_death, shadow_blades, death, potion_of_the_old_war
0:03.000 stealthed Z shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points bloodlust, temptation, master_of_subtlety_aura, stealth, symbols_of_death, shadow_blades, death, potion_of_the_old_war
0:04.005 stealthed Z shadowstrike Fluffy_Pillow 80.7/100: 81% energy | 3.0/6: 50% combo_points bloodlust, temptation, master_of_subtlety_aura, stealth, subterfuge, symbols_of_death, shadow_blades, potion_of_the_old_war
0:05.009 finish M nightblade Fluffy_Pillow 61.5/100: 61% energy | 6.0/6: 100% combo_points bloodlust, temptation, master_of_subtlety_aura, stealth, subterfuge, symbols_of_death, shadow_blades, potion_of_the_old_war
0:06.013 stealth_cds S shadow_dance Fluffy_Pillow 91.2/100: 91% energy | 0.0/6: 0% combo_points bloodlust, temptation, master_of_subtlety, symbols_of_death, shadow_blades, finality_nightblade(6), potion_of_the_old_war
0:06.013 stealthed Z shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points bloodlust, temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6), potion_of_the_old_war
0:07.018 stealthed Z shadowstrike Fluffy_Pillow 80.7/100: 81% energy | 4.0/6: 67% combo_points bloodlust, temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6), potion_of_the_old_war
0:08.023 finish N eviscerate Fluffy_Pillow 86.5/100: 86% energy | 6.0/6: 100% combo_points bloodlust, temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6), potion_of_the_old_war
0:09.028 stealthed Z shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points bloodlust, temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6), potion_of_the_old_war
0:10.032 stealthed Z shadowstrike Fluffy_Pillow 80.7/100: 81% energy | 4.0/6: 67% combo_points bloodlust, temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6), potion_of_the_old_war
0:11.038 finish N eviscerate Fluffy_Pillow 86.5/100: 86% energy | 6.0/6: 100% combo_points bloodlust, temptation, master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6), potion_of_the_old_war
0:12.042 build G backstab Fluffy_Pillow 100.0/100: 100% energy | 2.0/6: 33% combo_points bloodlust, temptation, master_of_subtlety, symbols_of_death, shadow_blades, finality_nightblade(6), potion_of_the_old_war
0:13.046 build G backstab Fluffy_Pillow 79.7/100: 80% energy | 4.0/6: 67% combo_points bloodlust, temptation, master_of_subtlety, symbols_of_death, shadow_blades, finality_nightblade(6), potion_of_the_old_war
0:14.050 finish N eviscerate Fluffy_Pillow 59.5/100: 59% energy | 6.0/6: 100% combo_points bloodlust, temptation, master_of_subtlety, symbols_of_death, shadow_blades, finality_nightblade(6), potion_of_the_old_war
0:15.052 stealth_cds S shadow_dance Fluffy_Pillow 79.2/100: 79% energy | 0.0/6: 0% combo_points bloodlust, temptation, master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6), potion_of_the_old_war
0:15.052 cds I use_item_ring_of_collapsing_futures Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points bloodlust, temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6), potion_of_the_old_war
0:15.052 stealthed X symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points bloodlust, temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6), potion_of_the_old_war
0:15.052 stealthed Z shadowstrike Fluffy_Pillow 65.0/100: 65% energy | 0.0/6: 0% combo_points bloodlust, temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, death, finality_eviscerate(6), finality_nightblade(6), potion_of_the_old_war
0:16.057 stealthed Z shadowstrike Fluffy_Pillow 45.7/100: 46% energy | 4.0/6: 67% combo_points bloodlust, temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6), potion_of_the_old_war
0:17.061 Waiting     0.600 sec 26.5/100: 26% energy | 6.0/6: 100% combo_points bloodlust, temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6), potion_of_the_old_war
0:17.661 finish M nightblade Fluffy_Pillow 35.3/100: 35% energy | 6.0/6: 100% combo_points bloodlust, temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6), potion_of_the_old_war
0:18.665 stealthed Z shadowstrike Fluffy_Pillow 65.0/100: 65% energy | 1.0/6: 17% combo_points bloodlust, temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), potion_of_the_old_war
0:19.671 stealthed Z shadowstrike Fluffy_Pillow 45.8/100: 46% energy | 4.0/6: 67% combo_points bloodlust, temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), potion_of_the_old_war
0:20.675 Waiting     0.600 sec 26.5/100: 27% energy | 6.0/6: 100% combo_points bloodlust, temptation(2), master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), potion_of_the_old_war
0:21.275 finish N eviscerate Fluffy_Pillow 35.3/100: 35% energy | 6.0/6: 100% combo_points bloodlust, temptation(2), master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), potion_of_the_old_war
0:22.281 cds L goremaws_bite Fluffy_Pillow 55.1/100: 55% energy | 0.0/6: 0% combo_points bloodlust, temptation(2), master_of_subtlety, symbols_of_death, shadow_blades, potion_of_the_old_war
0:23.285 build G backstab Fluffy_Pillow 74.8/100: 75% energy | 4.0/6: 67% combo_points bloodlust, temptation(2), master_of_subtlety, symbols_of_death, shadow_blades, goremaws_bite
0:24.288 finish N eviscerate Fluffy_Pillow 59.5/100: 60% energy | 6.0/6: 100% combo_points bloodlust, temptation(2), master_of_subtlety, symbols_of_death, shadow_blades, goremaws_bite
0:25.293 stealth_cds S shadow_dance Fluffy_Pillow 84.3/100: 84% energy | 1.0/6: 17% combo_points bloodlust, temptation(2), symbols_of_death, shadow_blades, goremaws_bite, finality_eviscerate(6)
0:25.293 stealthed X symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points bloodlust, temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, goremaws_bite, finality_eviscerate(6)
0:25.293 stealthed Z shadowstrike Fluffy_Pillow 65.0/100: 65% energy | 1.0/6: 17% combo_points bloodlust, temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, goremaws_bite, death, finality_eviscerate(6)
0:26.299 stealthed Z shadowstrike Fluffy_Pillow 75.8/100: 76% energy | 4.0/6: 67% combo_points bloodlust, temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, goremaws_bite, finality_eviscerate(6)
0:27.303 finish N eviscerate Fluffy_Pillow 86.5/100: 86% energy | 6.0/6: 100% combo_points bloodlust, temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, goremaws_bite, finality_eviscerate(6)
0:28.307 stealthed Z shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points bloodlust, temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades
0:29.312 stealthed Z shadowstrike Fluffy_Pillow 80.7/100: 81% energy | 4.0/6: 67% combo_points bloodlust, temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades
0:30.317 finish N eviscerate Fluffy_Pillow 61.5/100: 61% energy | 6.0/6: 100% combo_points bloodlust, temptation(2), master_of_subtlety, symbols_of_death, shadow_blades
0:31.322 build G backstab Fluffy_Pillow 100.0/100: 100% energy | 2.0/6: 33% combo_points bloodlust, temptation(2), master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6)
0:32.327 build G backstab Fluffy_Pillow 79.7/100: 80% energy | 4.0/6: 67% combo_points bloodlust, temptation(2), master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6)
0:33.331 finish N eviscerate Fluffy_Pillow 59.5/100: 59% energy | 6.0/6: 100% combo_points bloodlust, temptation(2), master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6)
0:34.336 stealth_cds S shadow_dance Fluffy_Pillow 79.2/100: 79% energy | 0.0/6: 0% combo_points bloodlust, temptation(2), master_of_subtlety, symbols_of_death, shadow_blades
0:34.336 cds I use_item_ring_of_collapsing_futures Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points bloodlust, temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades
0:34.336 stealthed Z shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points bloodlust, temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades
0:35.342 stealthed X symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 4.0/6: 67% combo_points bloodlust, temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades
0:35.342 stealthed Z shadowstrike Fluffy_Pillow 65.0/100: 65% energy | 4.0/6: 67% combo_points bloodlust, temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, death
0:36.347 finish N eviscerate Fluffy_Pillow 45.7/100: 46% energy | 6.0/6: 100% combo_points bloodlust, temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades
0:37.351 stealthed Z shadowstrike Fluffy_Pillow 65.5/100: 65% energy | 1.0/6: 17% combo_points bloodlust, temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6)
0:38.356 stealthed Z shadowstrike Fluffy_Pillow 71.2/100: 71% energy | 4.0/6: 67% combo_points bloodlust, temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6)
0:39.360 finish M nightblade Fluffy_Pillow 52.0/100: 52% energy | 6.0/6: 100% combo_points bloodlust, temptation(3), master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6)
0:40.365 stealth_cds T vanish Fluffy_Pillow 81.7/100: 82% energy | 1.0/6: 17% combo_points bloodlust, temptation(3), master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6)
0:40.365 stealthed Z shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points bloodlust, temptation(3), master_of_subtlety_aura, vanish, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6)
0:41.371 stealthed Z shadowstrike Fluffy_Pillow 77.4/100: 77% energy | 4.0/6: 67% combo_points temptation(3), master_of_subtlety_aura, vanish, subterfuge, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6)
0:42.376 finish N eviscerate Fluffy_Pillow 79.7/100: 80% energy | 6.0/6: 100% combo_points temptation(3), master_of_subtlety_aura, vanish, subterfuge, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6)
0:43.381 stealth_cds S shadow_dance Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points temptation(3), master_of_subtlety, symbols_of_death, shadow_blades, finality_nightblade(6)
0:43.381 stealthed Z shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6)
0:44.384 stealthed Z shadowstrike Fluffy_Pillow 77.3/100: 77% energy | 3.0/6: 50% combo_points temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6)
0:45.387 finish N eviscerate Fluffy_Pillow 54.6/100: 55% energy | 6.0/6: 100% combo_points temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6)
0:46.391 stealthed Z shadowstrike Fluffy_Pillow 71.0/100: 71% energy | 0.0/6: 0% combo_points temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6)
0:47.394 stealthed Z shadowstrike Fluffy_Pillow 48.3/100: 48% energy | 3.0/6: 50% combo_points temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6)
0:48.399 Waiting     0.900 sec 25.6/100: 26% energy | 6.0/6: 100% combo_points temptation(3), master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6)
0:49.299 finish N eviscerate Fluffy_Pillow 35.8/100: 36% energy | 6.0/6: 100% combo_points temptation(3), master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6)
0:50.303 stealth_cds U sprint Fluffy_Pillow 52.1/100: 52% energy | 0.0/6: 0% combo_points temptation(3), master_of_subtlety, symbols_of_death, shadow_blades, finality_nightblade(6)
0:50.303 stealth_cds V shadow_dance Fluffy_Pillow 52.1/100: 52% energy | 0.0/6: 0% combo_points temptation(3), master_of_subtlety, sprint, symbols_of_death, shadow_blades, finality_nightblade(6), faster_than_light_trigger
0:50.303 stealthed Z shadowstrike Fluffy_Pillow 77.1/100: 77% energy | 0.0/6: 0% combo_points temptation(3), master_of_subtlety_aura, shadow_dance, sprint, symbols_of_death, shadow_blades, finality_nightblade(6), faster_than_light_trigger
0:51.309 stealthed Z shadowstrike Fluffy_Pillow 54.5/100: 54% energy | 3.0/6: 50% combo_points temptation(3), master_of_subtlety_aura, shadow_dance, sprint, symbols_of_death, shadow_blades, finality_nightblade(6), faster_than_light_trigger
0:52.312 finish N eviscerate Fluffy_Pillow 56.8/100: 57% energy | 6.0/6: 100% combo_points temptation(3), master_of_subtlety_aura, shadow_dance, sprint, symbols_of_death, finality_nightblade(6), faster_than_light_trigger
0:53.315 stealthed X symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points temptation(3), master_of_subtlety_aura, shadow_dance, vanish, subterfuge, sprint, symbols_of_death, finality_eviscerate(6), finality_nightblade(6)
0:53.315 stealthed Z shadowstrike Fluffy_Pillow 65.0/100: 65% energy | 0.0/6: 0% combo_points temptation(3), master_of_subtlety_aura, shadow_dance, vanish, subterfuge, sprint, symbols_of_death, death, finality_eviscerate(6), finality_nightblade(6)
0:54.322 stealthed Z shadowstrike Fluffy_Pillow 42.4/100: 42% energy | 2.0/6: 33% combo_points temptation(3), master_of_subtlety_aura, shadow_dance, vanish, subterfuge, sprint, symbols_of_death, finality_eviscerate(6), finality_nightblade(6)
0:55.326 finish M nightblade Fluffy_Pillow 44.7/100: 45% energy | 5.0/6: 83% combo_points temptation(3), master_of_subtlety, vanish, subterfuge, sprint, symbols_of_death, finality_eviscerate(6), finality_nightblade(6)
0:56.330 build G backstab Fluffy_Pillow 96.0/100: 96% energy | 0.0/6: 0% combo_points temptation(3), master_of_subtlety, sprint, symbols_of_death, finality_eviscerate(6)
0:57.333 stealth_cds V shadow_dance Fluffy_Pillow 72.4/100: 72% energy | 1.0/6: 17% combo_points temptation(3), master_of_subtlety, sprint, symbols_of_death, finality_eviscerate(6)
0:57.333 stealthed Z shadowstrike Fluffy_Pillow 97.4/100: 97% energy | 1.0/6: 17% combo_points temptation(3), master_of_subtlety_aura, shadow_dance, sprint, symbols_of_death, finality_eviscerate(6)
0:58.339 stealthed Z shadowstrike Fluffy_Pillow 99.7/100: 100% energy | 4.0/6: 67% combo_points temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6)
0:59.343 finish N eviscerate Fluffy_Pillow 100.0/100: 100% energy | 6.0/6: 100% combo_points temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6)
1:00.349 stealthed Z shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death
1:01.353 stealthed Z shadowstrike Fluffy_Pillow 77.3/100: 77% energy | 2.0/6: 33% combo_points temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death
1:02.357 build G backstab Fluffy_Pillow 54.7/100: 55% energy | 4.0/6: 67% combo_points temptation(3), master_of_subtlety, symbols_of_death
1:03.359 Waiting     0.400 sec 31.0/100: 31% energy | 5.0/6: 83% combo_points temptation(3), master_of_subtlety, symbols_of_death
1:03.759 finish N eviscerate Fluffy_Pillow 35.5/100: 35% energy | 5.0/6: 83% combo_points temptation(3), master_of_subtlety, symbols_of_death
1:04.762 stealth_cds V shadow_dance Fluffy_Pillow 51.8/100: 52% energy | 1.0/6: 17% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5)
1:04.762 stealthed Z shadowstrike Fluffy_Pillow 76.8/100: 77% energy | 1.0/6: 17% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5)
1:05.767 stealthed Z shadowstrike Fluffy_Pillow 54.2/100: 54% energy | 3.0/6: 50% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5)
1:06.769 Waiting     0.400 sec 31.5/100: 31% energy | 5.0/6: 83% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5)
1:07.169 finish N eviscerate Fluffy_Pillow 36.0/100: 36% energy | 5.0/6: 83% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5)
1:08.172 stealthed Z shadowstrike Fluffy_Pillow 52.3/100: 52% energy | 1.0/6: 17% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
1:09.176 Waiting     1.900 sec 29.6/100: 30% energy | 3.0/6: 50% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
1:11.076 build G backstab Fluffy_Pillow 51.1/100: 51% energy | 4.0/6: 67% combo_points master_of_subtlety, symbols_of_death
1:12.081 Waiting     0.700 sec 27.4/100: 27% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death
1:12.781 finish N eviscerate Fluffy_Pillow 35.3/100: 35% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death
1:13.785 stealth_cds W shadow_dance Fluffy_Pillow 51.7/100: 52% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5)
1:13.785 stealthed Z shadowstrike Fluffy_Pillow 76.7/100: 77% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5)
1:14.789 stealthed Z shadowstrike Fluffy_Pillow 54.0/100: 54% energy | 3.0/6: 50% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5)
1:15.795 finish M nightblade Fluffy_Pillow 31.4/100: 31% energy | 5.0/6: 83% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5)
1:16.798 stealthed Z shadowstrike Fluffy_Pillow 57.7/100: 58% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5), finality_nightblade(5)
1:17.802 Waiting     0.500 sec 35.0/100: 35% energy | 3.0/6: 50% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5), finality_nightblade(5)
1:18.302 stealthed Z shadowstrike Fluffy_Pillow 40.7/100: 41% energy | 3.0/6: 50% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5), finality_nightblade(5)
1:19.306 Waiting     1.520 sec 18.0/100: 18% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5), finality_nightblade(5)
1:20.826 finish N eviscerate Fluffy_Pillow 35.1/100: 35% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5), finality_nightblade(5)
1:21.830 stealth_cds W shadow_dance Fluffy_Pillow 51.5/100: 51% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, finality_nightblade(5)
1:21.830 stealthed Z shadowstrike Fluffy_Pillow 76.5/100: 76% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(5)
1:22.835 stealthed Z shadowstrike Fluffy_Pillow 78.8/100: 79% energy | 3.0/6: 50% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(5)
1:23.840 finish N eviscerate Fluffy_Pillow 81.2/100: 81% energy | 5.0/6: 83% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(5)
1:24.844 stealthed X symbols_of_death Fluffy_Pillow 97.5/100: 98% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5), finality_nightblade(5)
1:24.844 stealthed Z shadowstrike Fluffy_Pillow 62.5/100: 63% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, death, finality_eviscerate(5), finality_nightblade(5)
1:25.849 Waiting     0.100 sec 39.9/100: 40% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5), finality_nightblade(5)
1:25.949 stealthed Z shadowstrike Fluffy_Pillow 41.0/100: 41% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5), finality_nightblade(5)
1:26.953 Waiting     0.692 sec 18.3/100: 18% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5), finality_nightblade(5)
1:27.645 finish M nightblade Fluffy_Pillow 26.1/100: 26% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5), finality_nightblade(5)
1:28.649 cds L goremaws_bite Fluffy_Pillow 52.5/100: 52% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5)
1:29.653 build G backstab Fluffy_Pillow 68.8/100: 69% energy | 3.0/6: 50% combo_points master_of_subtlety, symbols_of_death, goremaws_bite, finality_eviscerate(5)
1:30.658 finish N eviscerate Fluffy_Pillow 50.1/100: 50% energy | 6.0/6: 100% combo_points master_of_subtlety, symbols_of_death, goremaws_bite, finality_eviscerate(5)
1:31.662 stealth_cds W shadow_dance Fluffy_Pillow 71.5/100: 71% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, goremaws_bite
1:31.662 stealthed Z shadowstrike Fluffy_Pillow 96.5/100: 96% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, goremaws_bite
1:32.668 stealthed Z shadowstrike Fluffy_Pillow 78.8/100: 79% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, goremaws_bite
1:33.672 stealthed Z shadowstrike Fluffy_Pillow 61.2/100: 61% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, goremaws_bite
1:34.679 finish N eviscerate Fluffy_Pillow 43.5/100: 44% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
1:35.685 stealthed Z shadowstrike Fluffy_Pillow 59.9/100: 60% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6)
1:36.688 Waiting     1.300 sec 37.2/100: 37% energy | 4.0/6: 67% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(6)
1:37.988 finish N eviscerate Fluffy_Pillow 51.9/100: 52% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(6)
1:38.992 build G backstab Fluffy_Pillow 68.2/100: 68% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death
1:39.996 Waiting     0.200 sec 44.5/100: 45% energy | 1.0/6: 17% combo_points master_of_subtlety, symbols_of_death
1:40.196 stealth_cds W shadow_dance Fluffy_Pillow 46.8/100: 47% energy | 1.0/6: 17% combo_points master_of_subtlety, symbols_of_death
1:40.382 stealthed Z shadowstrike Fluffy_Pillow 73.9/100: 74% energy | 1.0/6: 17% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
1:41.387 stealthed Z shadowstrike Fluffy_Pillow 76.2/100: 76% energy | 3.0/6: 50% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
1:42.391 finish N eviscerate Fluffy_Pillow 53.6/100: 54% energy | 5.0/6: 83% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
1:43.397 stealthed Z shadowstrike Fluffy_Pillow 69.9/100: 70% energy | 1.0/6: 17% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5)
1:44.401 stealthed Z shadowstrike Fluffy_Pillow 47.3/100: 47% energy | 3.0/6: 50% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5)
1:45.406 Waiting     0.400 sec 24.6/100: 25% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5)
1:45.806 finish M nightblade Fluffy_Pillow 29.1/100: 29% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5)
1:46.811 build G backstab Fluffy_Pillow 55.5/100: 55% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5), finality_nightblade(5)
1:47.816 Waiting     1.700 sec 31.8/100: 32% energy | 1.0/6: 17% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5), finality_nightblade(5)
1:49.516 build G backstab Fluffy_Pillow 51.0/100: 51% energy | 3.0/6: 50% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5), finality_nightblade(5)
1:50.524 Waiting     2.100 sec 27.4/100: 27% energy | 4.0/6: 67% combo_points symbols_of_death, finality_eviscerate(5), finality_nightblade(5)
1:52.624 build G backstab Fluffy_Pillow 51.1/100: 51% energy | 4.0/6: 67% combo_points symbols_of_death, finality_eviscerate(5), finality_nightblade(5)
1:53.627 Waiting     0.700 sec 27.4/100: 27% energy | 5.0/6: 83% combo_points symbols_of_death, finality_eviscerate(5), finality_nightblade(5)
1:54.327 finish N eviscerate Fluffy_Pillow 35.3/100: 35% energy | 6.0/6: 100% combo_points symbols_of_death, finality_eviscerate(5), finality_nightblade(5)
1:55.332 stealth_cds W shadow_dance Fluffy_Pillow 51.7/100: 52% energy | 0.0/6: 0% combo_points symbols_of_death, finality_nightblade(5)
1:55.332 stealthed Z shadowstrike Fluffy_Pillow 76.7/100: 77% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(5)
1:56.338 stealthed Z shadowstrike Fluffy_Pillow 79.0/100: 79% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(5)
1:57.343 stealthed Z shadowstrike Fluffy_Pillow 56.4/100: 56% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(5)
1:58.346 Waiting     0.100 sec 33.7/100: 34% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(5)
1:58.446 finish M nightblade Fluffy_Pillow 34.8/100: 35% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(5)
1:59.451 stealthed Z shadowstrike Fluffy_Pillow 61.2/100: 61% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
2:00.456 Waiting     1.200 sec 38.5/100: 39% energy | 4.0/6: 67% combo_points master_of_subtlety, symbols_of_death
2:01.656 build G backstab Fluffy_Pillow 52.0/100: 52% energy | 4.0/6: 67% combo_points master_of_subtlety, symbols_of_death
2:02.660 Waiting     0.600 sec 28.4/100: 28% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death
2:03.260 finish N eviscerate Fluffy_Pillow 35.2/100: 35% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death
2:04.263 build G backstab Fluffy_Pillow 51.5/100: 51% energy | 1.0/6: 17% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5)
2:05.267 Waiting     2.100 sec 27.8/100: 28% energy | 2.0/6: 33% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5)
2:07.367 build G backstab Fluffy_Pillow 51.5/100: 52% energy | 2.0/6: 33% combo_points symbols_of_death, finality_eviscerate(5)
2:08.371 Waiting     2.100 sec 27.9/100: 28% energy | 4.0/6: 67% combo_points symbols_of_death, finality_eviscerate(5)
2:10.471 build G backstab Fluffy_Pillow 51.6/100: 52% energy | 4.0/6: 67% combo_points finality_eviscerate(5)
2:11.477 Waiting     0.700 sec 27.9/100: 28% energy | 6.0/6: 100% combo_points finality_eviscerate(5)
2:12.177 finish N eviscerate Fluffy_Pillow 35.8/100: 36% energy | 6.0/6: 100% combo_points finality_eviscerate(5)
2:13.183 stealth_cds W shadow_dance Fluffy_Pillow 52.2/100: 52% energy | 0.0/6: 0% combo_points
2:13.183 stealthed X symbols_of_death Fluffy_Pillow 77.2/100: 77% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance
2:13.183 stealthed Z shadowstrike Fluffy_Pillow 42.2/100: 42% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, death
2:14.186 Waiting     1.887 sec 19.5/100: 19% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
2:16.073 stealthed Z shadowstrike Fluffy_Pillow 40.8/100: 41% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
2:17.076 Waiting     1.509 sec 18.1/100: 18% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
2:18.585 finish N eviscerate Fluffy_Pillow 35.1/100: 35% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death
2:19.589 build G backstab Fluffy_Pillow 51.5/100: 51% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5)
2:20.593 Waiting     2.100 sec 27.8/100: 28% energy | 1.0/6: 17% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5)
2:22.693 build G backstab Fluffy_Pillow 51.5/100: 52% energy | 2.0/6: 33% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5)
2:23.698 Waiting     2.100 sec 27.9/100: 28% energy | 3.0/6: 50% combo_points symbols_of_death, finality_eviscerate(5)
2:25.798 build G backstab Fluffy_Pillow 51.6/100: 52% energy | 3.0/6: 50% combo_points symbols_of_death, finality_eviscerate(5)
2:26.803 Waiting     0.600 sec 27.9/100: 28% energy | 4.0/6: 67% combo_points symbols_of_death, finality_eviscerate(5)
2:27.403 finish M nightblade Fluffy_Pillow 34.7/100: 35% energy | 5.0/6: 83% combo_points symbols_of_death, finality_eviscerate(5)
2:28.407 cds L goremaws_bite Fluffy_Pillow 61.0/100: 61% energy | 0.0/6: 0% combo_points symbols_of_death, finality_eviscerate(5), finality_nightblade(5)
2:29.652 build G backstab Fluffy_Pillow 80.1/100: 80% energy | 3.0/6: 50% combo_points symbols_of_death, goremaws_bite, finality_eviscerate(5), finality_nightblade(5)
2:30.656 finish N eviscerate Fluffy_Pillow 61.4/100: 61% energy | 5.0/6: 83% combo_points symbols_of_death, goremaws_bite, finality_eviscerate(5), finality_nightblade(5)
2:31.662 stealth_cds W shadow_dance Fluffy_Pillow 82.8/100: 83% energy | 0.0/6: 0% combo_points symbols_of_death, goremaws_bite, finality_nightblade(5)
2:31.662 stealthed X symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, goremaws_bite, finality_nightblade(5)
2:31.662 stealthed Z shadowstrike Fluffy_Pillow 65.0/100: 65% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, goremaws_bite, death, finality_nightblade(5)
2:32.666 stealthed Z shadowstrike Fluffy_Pillow 47.3/100: 47% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, goremaws_bite, finality_nightblade(5)
2:33.671 Waiting     0.500 sec 29.7/100: 30% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, goremaws_bite, finality_nightblade(5)
2:34.171 finish N eviscerate Fluffy_Pillow 35.3/100: 35% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, goremaws_bite, finality_nightblade(5)
2:35.175 stealthed Z shadowstrike Fluffy_Pillow 96.7/100: 97% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6), finality_nightblade(5)
2:36.178 stealthed Z shadowstrike Fluffy_Pillow 74.0/100: 74% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6), finality_nightblade(5)
2:37.180 build G backstab Fluffy_Pillow 51.3/100: 51% energy | 4.0/6: 67% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(6), finality_nightblade(5)
2:38.186 Waiting     0.400 sec 27.6/100: 28% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(6), finality_nightblade(5)
2:38.586 finish M nightblade Fluffy_Pillow 32.2/100: 32% energy | 6.0/6: 100% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(6), finality_nightblade(5)
2:39.592 build G backstab Fluffy_Pillow 58.5/100: 59% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(6)
2:40.596 Waiting     1.500 sec 34.8/100: 35% energy | 1.0/6: 17% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(6)
2:42.096 stealth_cds T vanish Fluffy_Pillow 51.8/100: 52% energy | 3.0/6: 50% combo_points symbols_of_death, finality_eviscerate(6)
2:42.096 stealthed Z shadowstrike Fluffy_Pillow 76.8/100: 77% energy | 3.0/6: 50% combo_points master_of_subtlety_aura, vanish, symbols_of_death, finality_eviscerate(6)
2:43.101 finish N eviscerate Fluffy_Pillow 79.1/100: 79% energy | 5.0/6: 83% combo_points master_of_subtlety_aura, vanish, subterfuge, symbols_of_death, finality_eviscerate(6)
2:44.104 stealthed Z shadowstrike Fluffy_Pillow 95.4/100: 95% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, vanish, subterfuge, symbols_of_death
2:45.108 build G backstab Fluffy_Pillow 100.0/100: 100% energy | 4.0/6: 67% combo_points master_of_subtlety, symbols_of_death
2:46.112 finish N eviscerate Fluffy_Pillow 76.3/100: 76% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death
2:47.117 stealth_cds W shadow_dance Fluffy_Pillow 92.7/100: 93% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5)
2:47.117 stealthed X symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5)
2:47.117 stealthed Z shadowstrike Fluffy_Pillow 65.0/100: 65% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, death, finality_eviscerate(5)
2:48.121 stealthed Z shadowstrike Fluffy_Pillow 42.3/100: 42% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5)
2:49.125 finish N eviscerate Fluffy_Pillow 44.7/100: 45% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5)
2:50.129 stealthed Z shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
2:51.132 stealthed Z shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
2:52.136 build G backstab Fluffy_Pillow 100.0/100: 100% energy | 4.0/6: 67% combo_points master_of_subtlety, symbols_of_death
2:53.139 finish N eviscerate Fluffy_Pillow 76.3/100: 76% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death
2:54.144 stealth_cds U sprint Fluffy_Pillow 92.7/100: 93% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5)
2:54.144 stealth_cds W shadow_dance Fluffy_Pillow 92.7/100: 93% energy | 0.0/6: 0% combo_points master_of_subtlety, sprint, symbols_of_death, finality_eviscerate(5), faster_than_light_trigger
2:54.144 stealthed Z shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, sprint, symbols_of_death, finality_eviscerate(5), faster_than_light_trigger
2:55.147 stealthed Z shadowstrike Fluffy_Pillow 77.3/100: 77% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, sprint, symbols_of_death, finality_eviscerate(5), faster_than_light_trigger
2:56.153 stealthed Z shadowstrike Fluffy_Pillow 54.7/100: 55% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, shadow_dance, sprint, symbols_of_death, finality_eviscerate(5), faster_than_light_trigger
2:57.158 finish N eviscerate Fluffy_Pillow 82.0/100: 82% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, vanish, subterfuge, sprint, symbols_of_death, finality_eviscerate(5)
2:58.163 stealthed X symbols_of_death Fluffy_Pillow 98.4/100: 98% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, vanish, subterfuge, sprint, symbols_of_death
2:58.163 stealthed Z shadowstrike Fluffy_Pillow 63.4/100: 63% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, vanish, subterfuge, sprint, symbols_of_death, death
2:59.166 stealthed Z shadowstrike Fluffy_Pillow 65.7/100: 66% energy | 2.0/6: 33% combo_points master_of_subtlety, vanish, subterfuge, sprint, symbols_of_death
3:00.172 cds K shadow_blades Fluffy_Pillow 93.0/100: 93% energy | 4.0/6: 67% combo_points master_of_subtlety, sprint, symbols_of_death
3:00.172 cds H potion Fluffy_Pillow 93.0/100: 93% energy | 4.0/6: 67% combo_points master_of_subtlety, sprint, symbols_of_death, shadow_blades
3:00.172 build G backstab Fluffy_Pillow 93.0/100: 93% energy | 4.0/6: 67% combo_points master_of_subtlety, sprint, symbols_of_death, shadow_blades, potion_of_the_old_war
3:01.175 finish M nightblade Fluffy_Pillow 69.4/100: 69% energy | 6.0/6: 100% combo_points master_of_subtlety, sprint, symbols_of_death, shadow_blades, potion_of_the_old_war
3:02.180 stealth_cds W shadow_dance Fluffy_Pillow 95.7/100: 96% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_nightblade(6), potion_of_the_old_war
3:02.180 cds J use_item_draught_of_souls Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6), potion_of_the_old_war
3:05.180 stealthed Z shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6), potion_of_the_old_war
3:06.186 stealthed Z shadowstrike Fluffy_Pillow 77.4/100: 77% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6), potion_of_the_old_war
3:07.190 finish N eviscerate Fluffy_Pillow 54.7/100: 55% energy | 6.0/6: 100% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_nightblade(6), potion_of_the_old_war
3:08.195 build G backstab Fluffy_Pillow 71.0/100: 71% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6), potion_of_the_old_war
3:09.197 Waiting     0.400 sec 47.3/100: 47% energy | 2.0/6: 33% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6), potion_of_the_old_war
3:09.597 build G backstab Fluffy_Pillow 51.9/100: 52% energy | 2.0/6: 33% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6), potion_of_the_old_war
3:10.602 Waiting     0.700 sec 28.2/100: 28% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6), potion_of_the_old_war
3:11.302 finish N eviscerate Fluffy_Pillow 36.1/100: 36% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6), potion_of_the_old_war
3:12.306 build G backstab Fluffy_Pillow 52.4/100: 52% energy | 0.0/6: 0% combo_points symbols_of_death, shadow_blades, finality_nightblade(6), potion_of_the_old_war
3:13.310 Waiting     2.000 sec 28.8/100: 29% energy | 2.0/6: 33% combo_points symbols_of_death, shadow_blades, finality_nightblade(6), potion_of_the_old_war
3:15.310 build G backstab Fluffy_Pillow 51.4/100: 51% energy | 4.0/6: 67% combo_points symbols_of_death, shadow_blades, finality_nightblade(6), potion_of_the_old_war
3:16.314 finish M nightblade Fluffy_Pillow 27.7/100: 28% energy | 6.0/6: 100% combo_points symbols_of_death, shadow_blades, finality_nightblade(6), potion_of_the_old_war
3:17.318 stealth_cds W shadow_dance Fluffy_Pillow 54.0/100: 54% energy | 0.0/6: 0% combo_points symbols_of_death, shadow_blades, potion_of_the_old_war
3:17.318 stealthed Z shadowstrike Fluffy_Pillow 79.0/100: 79% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, potion_of_the_old_war
3:18.323 stealthed Z shadowstrike Fluffy_Pillow 56.4/100: 56% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, potion_of_the_old_war
3:19.329 Waiting     0.200 sec 33.7/100: 34% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, potion_of_the_old_war
3:19.529 finish N eviscerate Fluffy_Pillow 36.0/100: 36% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, potion_of_the_old_war
3:20.535 stealthed Z shadowstrike Fluffy_Pillow 52.3/100: 52% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), potion_of_the_old_war
3:21.540 Waiting     1.900 sec 29.7/100: 30% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), potion_of_the_old_war
3:23.440 build G backstab Fluffy_Pillow 51.1/100: 51% energy | 4.0/6: 67% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), potion_of_the_old_war
3:24.444 Waiting     0.700 sec 27.5/100: 27% energy | 6.0/6: 100% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), potion_of_the_old_war
3:25.144 finish N eviscerate Fluffy_Pillow 35.4/100: 35% energy | 6.0/6: 100% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), potion_of_the_old_war
3:26.148 build G backstab Fluffy_Pillow 51.7/100: 52% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, shadow_blades
3:27.151 Waiting     2.100 sec 28.0/100: 28% energy | 2.0/6: 33% combo_points master_of_subtlety, symbols_of_death, shadow_blades
3:29.251 build G backstab Fluffy_Pillow 51.7/100: 52% energy | 3.0/6: 50% combo_points symbols_of_death, shadow_blades
3:30.255 Waiting     0.700 sec 28.1/100: 28% energy | 5.0/6: 83% combo_points symbols_of_death, shadow_blades
3:30.955 finish N eviscerate Fluffy_Pillow 36.0/100: 36% energy | 5.0/6: 83% combo_points symbols_of_death, shadow_blades
3:31.959 cds L goremaws_bite Fluffy_Pillow 52.3/100: 52% energy | 0.0/6: 0% combo_points symbols_of_death, shadow_blades, finality_eviscerate(5)
3:32.963 build G backstab Fluffy_Pillow 68.6/100: 69% energy | 4.0/6: 67% combo_points symbols_of_death, shadow_blades, goremaws_bite, finality_eviscerate(5)
3:33.968 finish N eviscerate Fluffy_Pillow 50.0/100: 50% energy | 6.0/6: 100% combo_points symbols_of_death, shadow_blades, goremaws_bite, finality_eviscerate(5)
3:34.972 stealth_cds W shadow_dance Fluffy_Pillow 71.3/100: 71% energy | 0.0/6: 0% combo_points symbols_of_death, shadow_blades, goremaws_bite
3:34.972 stealthed X symbols_of_death Fluffy_Pillow 96.3/100: 96% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, goremaws_bite
3:34.972 stealthed Z shadowstrike Fluffy_Pillow 61.3/100: 61% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, goremaws_bite, death
3:35.976 stealthed Z shadowstrike Fluffy_Pillow 43.6/100: 44% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, goremaws_bite
3:36.982 finish M nightblade Fluffy_Pillow 26.0/100: 26% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, goremaws_bite
3:37.986 stealthed Z shadowstrike Fluffy_Pillow 97.3/100: 97% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6)
3:38.992 stealthed Z shadowstrike Fluffy_Pillow 99.7/100: 100% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6)
3:39.995 finish N eviscerate Fluffy_Pillow 77.0/100: 77% energy | 6.0/6: 100% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_nightblade(6)
3:40.997 stealth_cds W shadow_dance Fluffy_Pillow 93.3/100: 93% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6)
3:40.997 stealthed Z shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6)
3:42.001 stealthed Z shadowstrike Fluffy_Pillow 77.3/100: 77% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6)
3:43.007 finish N eviscerate Fluffy_Pillow 54.7/100: 55% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6), finality_nightblade(6)
3:44.012 stealthed Z shadowstrike Fluffy_Pillow 71.0/100: 71% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(6)
3:45.017 stealthed Z shadowstrike Fluffy_Pillow 48.4/100: 48% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(6)
3:46.021 Waiting     0.900 sec 25.7/100: 26% energy | 4.0/6: 67% combo_points master_of_subtlety, symbols_of_death, finality_nightblade(6)
3:46.921 finish N eviscerate Fluffy_Pillow 35.9/100: 36% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death, finality_nightblade(6)
3:47.926 build G backstab Fluffy_Pillow 52.2/100: 52% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5), finality_nightblade(6)
3:48.930 Waiting     2.000 sec 28.5/100: 29% energy | 1.0/6: 17% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5), finality_nightblade(6)
3:50.930 build G backstab Fluffy_Pillow 51.1/100: 51% energy | 1.0/6: 17% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5), finality_nightblade(6)
3:51.935 Waiting     2.100 sec 27.5/100: 27% energy | 3.0/6: 50% combo_points symbols_of_death, finality_eviscerate(5), finality_nightblade(6)
3:54.035 build G backstab Fluffy_Pillow 51.2/100: 51% energy | 3.0/6: 50% combo_points symbols_of_death, finality_eviscerate(5), finality_nightblade(6)
3:55.041 Waiting     1.100 sec 27.5/100: 28% energy | 4.0/6: 67% combo_points symbols_of_death, finality_eviscerate(5), finality_nightblade(6)
3:56.141 finish M nightblade Fluffy_Pillow 39.9/100: 40% energy | 6.0/6: 100% combo_points symbols_of_death, finality_eviscerate(5), finality_nightblade(6)
3:57.146 stealth_cds W shadow_dance Fluffy_Pillow 66.3/100: 66% energy | 0.0/6: 0% combo_points symbols_of_death, finality_eviscerate(5)
3:57.146 stealthed Z shadowstrike Fluffy_Pillow 91.3/100: 91% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5)
3:58.151 stealthed Z shadowstrike Fluffy_Pillow 68.6/100: 69% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5)
3:59.156 stealthed Z shadowstrike Fluffy_Pillow 46.0/100: 46% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5)
4:00.159 Waiting     1.050 sec 23.3/100: 23% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5)
4:01.209 finish N eviscerate Fluffy_Pillow 35.2/100: 35% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5)
4:02.214 build G backstab Fluffy_Pillow 51.5/100: 52% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death
4:03.220 Waiting     2.100 sec 27.9/100: 28% energy | 1.0/6: 17% combo_points master_of_subtlety, symbols_of_death
4:05.320 build G backstab Fluffy_Pillow 51.6/100: 52% energy | 2.0/6: 33% combo_points master_of_subtlety, symbols_of_death
4:06.324 Waiting     2.100 sec 27.9/100: 28% energy | 3.0/6: 50% combo_points master_of_subtlety, symbols_of_death
4:08.424 build G backstab Fluffy_Pillow 51.6/100: 52% energy | 4.0/6: 67% combo_points symbols_of_death
4:09.428 Waiting     0.700 sec 27.9/100: 28% energy | 5.0/6: 83% combo_points symbols_of_death
4:10.128 finish N eviscerate Fluffy_Pillow 35.8/100: 36% energy | 5.0/6: 83% combo_points symbols_of_death
4:11.134 build G backstab Fluffy_Pillow 52.2/100: 52% energy | 2.0/6: 33% combo_points symbols_of_death, finality_eviscerate(5)
4:12.140 Waiting     2.000 sec 28.6/100: 29% energy | 3.0/6: 50% combo_points symbols_of_death, finality_eviscerate(5)
4:14.140 build G backstab Fluffy_Pillow 51.1/100: 51% energy | 4.0/6: 67% combo_points symbols_of_death, finality_eviscerate(5)
4:15.144 finish M nightblade Fluffy_Pillow 27.5/100: 27% energy | 5.0/6: 83% combo_points symbols_of_death, finality_eviscerate(5)
4:16.147 stealth_cds W shadow_dance Fluffy_Pillow 53.8/100: 54% energy | 0.0/6: 0% combo_points symbols_of_death, finality_eviscerate(5), finality_nightblade(5)
4:16.147 stealthed X symbols_of_death Fluffy_Pillow 78.8/100: 79% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5), finality_nightblade(5)
4:16.147 stealthed Z shadowstrike Fluffy_Pillow 43.8/100: 44% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, death, finality_eviscerate(5), finality_nightblade(5)
4:17.151 stealthed Z shadowstrike Fluffy_Pillow 46.1/100: 46% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5), finality_nightblade(5)
4:18.158 Waiting     1.034 sec 23.5/100: 23% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5), finality_nightblade(5)
4:19.192 finish N eviscerate Fluffy_Pillow 35.2/100: 35% energy | 5.0/6: 83% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5), finality_nightblade(5)
4:20.196 stealthed Z shadowstrike Fluffy_Pillow 51.5/100: 51% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(5)
4:21.201 Waiting     2.000 sec 28.8/100: 29% energy | 2.0/6: 33% combo_points master_of_subtlety, symbols_of_death, finality_nightblade(5)
4:23.201 build G backstab Fluffy_Pillow 51.4/100: 51% energy | 2.0/6: 33% combo_points master_of_subtlety, symbols_of_death, finality_nightblade(5)
4:24.207 Waiting     2.100 sec 27.8/100: 28% energy | 4.0/6: 67% combo_points master_of_subtlety, symbols_of_death, finality_nightblade(5)
4:26.307 build G backstab Fluffy_Pillow 51.5/100: 51% energy | 4.0/6: 67% combo_points symbols_of_death, finality_nightblade(5)
4:27.312 finish M nightblade Fluffy_Pillow 27.8/100: 28% energy | 5.0/6: 83% combo_points symbols_of_death, finality_nightblade(5)
4:28.314 build G backstab Fluffy_Pillow 54.1/100: 54% energy | 2.0/6: 33% combo_points symbols_of_death
4:29.319 Waiting     1.900 sec 30.5/100: 30% energy | 3.0/6: 50% combo_points symbols_of_death
4:31.219 build G backstab Fluffy_Pillow 51.9/100: 52% energy | 3.0/6: 50% combo_points symbols_of_death
4:32.225 Waiting     0.600 sec 28.3/100: 28% energy | 4.0/6: 67% combo_points symbols_of_death
4:32.825 finish N eviscerate Fluffy_Pillow 35.0/100: 35% energy | 5.0/6: 83% combo_points symbols_of_death
4:33.829 cds L goremaws_bite Fluffy_Pillow 51.4/100: 51% energy | 0.0/6: 0% combo_points symbols_of_death, finality_eviscerate(5)
4:34.834 cds J use_item_draught_of_souls Fluffy_Pillow 67.7/100: 68% energy | 3.0/6: 50% combo_points symbols_of_death, goremaws_bite, finality_eviscerate(5)
4:37.834 build G backstab Fluffy_Pillow 100.0/100: 100% energy | 4.0/6: 67% combo_points symbols_of_death, goremaws_bite, finality_eviscerate(5)
4:38.838 finish N eviscerate Fluffy_Pillow 81.3/100: 81% energy | 5.0/6: 83% combo_points symbols_of_death, goremaws_bite, finality_eviscerate(5)
4:39.843 stealth_cds W shadow_dance Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points symbols_of_death
4:39.843 stealthed X symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
4:39.843 stealthed Z shadowstrike Fluffy_Pillow 65.0/100: 65% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, death
4:40.848 stealthed Z shadowstrike Fluffy_Pillow 42.3/100: 42% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
4:41.854 Waiting     1.369 sec 19.7/100: 20% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
4:43.223 finish N eviscerate Fluffy_Pillow 35.2/100: 35% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
4:44.227 stealthed Z shadowstrike Fluffy_Pillow 51.5/100: 51% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6)
4:45.233 stealth_cds T vanish Fluffy_Pillow 53.8/100: 54% energy | 2.0/6: 33% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(6)
4:45.233 stealthed Z shadowstrike Fluffy_Pillow 78.8/100: 79% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, vanish, symbols_of_death, finality_eviscerate(6)
4:46.240 stealthed Z shadowstrike Fluffy_Pillow 56.2/100: 56% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, vanish, subterfuge, symbols_of_death, finality_eviscerate(6)
4:47.243 Waiting     0.200 sec 33.5/100: 34% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, vanish, subterfuge, symbols_of_death, finality_eviscerate(6)
4:47.443 finish N eviscerate Fluffy_Pillow 35.8/100: 36% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, vanish, subterfuge, symbols_of_death, finality_eviscerate(6)
4:48.446 stealth_cds W shadow_dance Fluffy_Pillow 77.1/100: 77% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death
4:48.446 stealthed Z shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
4:49.450 stealthed Z shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
4:50.453 finish N eviscerate Fluffy_Pillow 77.3/100: 77% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
4:51.458 stealthed Z shadowstrike Fluffy_Pillow 93.7/100: 94% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6)
4:52.463 stealthed Z shadowstrike Fluffy_Pillow 71.0/100: 71% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 8806 8481 0
Agility 30616 28910 18504 (10748)
Stamina 48391 48391 28183
Intellect 5325 5000 0
Spirit 0 0 0
Health 2903460 2903460 0
Energy 100 100 0
Combo Points 6 6 0
Crit 23.64% 23.64% 5456
Haste 12.88% 12.88% 4831
Damage / Heal Versatility 9.03% 8.23% 3909
Attack Power 30616 28910 0
Mastery 80.81% 80.81% 8510
Armor 2297 2297 2297
Run Speed 8 0 0

Gear

Source Slot Average Item Level: 891.00
Local Head Cowl of Fright
ilevel: 885, stats: { 300 Armor, +2829 Sta, +1886 AgiInt, +1015 Mastery, +547 Crit, +1076 unknown }
Local Neck Sea Fan Pendant
ilevel: 880, stats: { +1519 Sta, +1633 Vers, +965 Mastery }, enchant: mark_of_the_hidden_satyr
Local Shoulders Steelgazer Hide Mantle
ilevel: 880, stats: { 273 Armor, +1351 AgiInt, +2027 Sta, +673 Haste, +476 Vers, +771 unknown }
Local Shirt Common Gray Shirt
ilevel: 1
Local Chest Biornskin Vest
ilevel: 890, stats: { 376 Armor, +1977 AgiInt, +2965 Sta, +1034 Crit, +557 Mastery }
Local Waist Strand of Whelk Shells
ilevel: 880, stats: { 205 Armor, +2026 Sta, +1351 AgiInt, +673 Haste, +476 Mastery }, gems: { +150 Mastery }
Local Legs Legwraps of Unworthy Souls
ilevel: 880, stats: { 318 Armor, +2701 Sta, +1801 AgiInt, +964 Mastery, +570 Haste }
Local Feet Shadow Satyr's Walk
ilevel: 910, stats: { 276 Armor, +2680 Sta, +1786 Agi, +827 Haste, +459 Mastery }
Local Wrists Denial of the Half-Giants
ilevel: 910, stats: { 176 Armor, +2010 Sta, +1340 Agi, +276 Crit, +689 Mastery }
Local Hands Cruel Vice Grips
ilevel: 885, stats: { 231 Armor, +2122 Sta, +1415 AgiInt, +686 Crit, +485 Mastery }
Local Finger1 Grubby Silver Ring
ilevel: 880, stats: { +1519 Sta, +1484 Crit, +1114 Vers }, gems: { +150 Vers }, enchant: { +200 Mastery }
Local Finger2 Ring of Collapsing Futures
ilevel: 870, stats: { +1385 Sta, +1677 Mastery, +768 Haste, +419 Avoidance }, enchant: { +200 Vers }
Local Trinket1 Arcanogolem Digit
ilevel: 910, stats: { +2264 Agi }
Local Trinket2 Draught of Souls
ilevel: 910, stats: { +1225 Haste }
Local Back Drape of the Mana-Starved
ilevel: 875, stats: { 142 Armor, +1450 Sta, +967 StrAgiInt, +586 Crit, +259 Vers }, gems: { +200 Agi }, enchant: { +200 Agi }
Local Main Hand Fangs of the Devourer
ilevel: 906, weapon: { 3844 - 7140, 1.8 }, stats: { +983 Agi, +1475 Sta, +368 Crit, +353 Mastery }, relics: { +53 ilevels, +51 ilevels, +52 ilevels }
Local Off Hand Fangs of the Devourer
ilevel: 906, weapon: { 3844 - 7140, 1.8 }, stats: { +983 Agi, +1475 Sta, +368 Crit, +353 Mastery }

Talents

Level
15 Master of Subtlety (Subtlety Rogue) Weaponmaster (Subtlety Rogue) Gloomblade (Subtlety Rogue)
30 Nightstalker Subterfuge Shadow Focus
45 Deeper Stratagem Anticipation Vigor
60 Soothing Darkness (Subtlety Rogue) Elusiveness Cheat Death
75 Strike from the Shadows (Subtlety Rogue) Prey on the Weak Tangled Shadow (Subtlety Rogue)
90 Premeditation (Subtlety Rogue) Alacrity Enveloping Shadows (Subtlety Rogue)
100 Master of Shadows (Subtlety Rogue) Marked for Death Death from Above

Profile

rogue="AD+DoS"
origin="https://eu.api.battle.net/wow/character/dalaran/Esdeåth/advanced"
level=110
race=human
role=attack
position=back
professions=alchemy=800/enchanting=133
talents=1210011
artifact=17:0:0:0:0:851:1:852:3:853:3:854:3:855:3:856:3:857:3:858:3:859:3:860:3:861:1:862:1:863:1:864:1:865:1:866:1:1349:1:1386:14
spec=subtlety

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,name=flask_of_the_seventh_demon
actions.precombat+=/augmentation,name=defiled
actions.precombat+=/food,name=seedbattered_fish_plate
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/stealth
actions.precombat+=/potion,name=old_war
actions.precombat+=/marked_for_death,if=raid_event.adds.in>40
# Defined variables that doesn't change during the fight
actions.precombat+=/variable,name=ssw_refund,value=equipped.shadow_satyrs_walk*(4+ssw_refund_offset)
actions.precombat+=/variable,name=stealth_threshold,value=(15+talent.vigor.enabled*35+talent.master_of_shadows.enabled*30+variable.ssw_refund)
actions.precombat+=/enveloping_shadows,if=combo_points>=5
actions.precombat+=/symbols_of_death

# Executed every time the actor is available.
actions=call_action_list,name=cds
# Fully switch to the Stealthed Rotation (by doing so, it forces pooling if nothing is available)
actions+=/run_action_list,name=stealthed,if=stealthed.all
actions+=/call_action_list,name=finish,if=combo_points>=5|(combo_points>=4&spell_targets.shuriken_storm>=3&spell_targets.shuriken_storm<=4)
actions+=/call_action_list,name=stealth_als,if=combo_points.deficit>=2+talent.premeditation.enabled
actions+=/call_action_list,name=build,if=energy.deficit<=variable.stealth_threshold

# Builders
actions.build=shuriken_storm,if=spell_targets.shuriken_storm>=2
actions.build+=/gloomblade
actions.build+=/backstab

# Cooldowns
actions.cds=potion,name=old_war,if=buff.bloodlust.react|target.time_to_die<=25|buff.shadow_blades.up
actions.cds+=/use_item,slot=finger2,if=(buff.shadow_blades.up&stealthed.rogue)|target.time_to_die<20
actions.cds+=/use_item,slot=trinket2,if=(buff.shadow_blades.up&stealthed.rogue)|target.time_to_die<20
actions.cds+=/blood_fury,if=stealthed.rogue
actions.cds+=/berserking,if=stealthed.rogue
actions.cds+=/arcane_torrent,if=stealthed.rogue&energy.deficit>70
actions.cds+=/shadow_blades,if=combo_points<=2|(equipped.denial_of_the_halfgiants&combo_points>=1)
actions.cds+=/goremaws_bite,if=!stealthed.all&cooldown.shadow_dance.charges_fractional<=2.45&((combo_points.deficit>=4-(time<10)*2&energy.deficit>50+talent.vigor.enabled*25-(time>=10)*15)|target.time_to_die<8)
actions.cds+=/marked_for_death,target_if=min:target.time_to_die,if=target.time_to_die<combo_points.deficit|(raid_event.adds.in>40&combo_points.deficit>=4+talent.deeper_strategem.enabled+talent.anticipation.enabled)

# Finishers
actions.finish=enveloping_shadows,if=buff.enveloping_shadows.remains<target.time_to_die&buff.enveloping_shadows.remains<=combo_points*1.8
actions.finish+=/death_from_above,if=spell_targets.death_from_above>=6
actions.finish+=/nightblade,cycle_targets=1,if=target.time_to_die>8&((refreshable&(!finality|buff.finality_nightblade.up))|remains<tick_time)
actions.finish+=/death_from_above
actions.finish+=/eviscerate

# Stealth Action List Starter
actions.stealth_als=call_action_list,name=stealth_cds,if=energy.deficit<=variable.stealth_threshold&(!equipped.shadow_satyrs_walk|cooldown.shadow_dance.charges_fractional>=2.45|energy.deficit>=10)
actions.stealth_als+=/call_action_list,name=stealth_cds,if=spell_targets.shuriken_storm>=5
actions.stealth_als+=/call_action_list,name=stealth_cds,if=(cooldown.shadowmeld.up&!cooldown.vanish.up&cooldown.shadow_dance.charges<=1)
actions.stealth_als+=/call_action_list,name=stealth_cds,if=target.time_to_die<12*cooldown.shadow_dance.charges_fractional*(1+equipped.shadow_satyrs_walk*0.5)

# Stealth Cooldowns
actions.stealth_cds=shadow_dance,if=charges_fractional>=2.45
actions.stealth_cds+=/vanish
actions.stealth_cds+=/sprint_offensive
actions.stealth_cds+=/shadow_dance,if=charges>=2&combo_points<=1
actions.stealth_cds+=/pool_resource,for_next=1,extra_amount=40
actions.stealth_cds+=/shadowmeld,if=energy>=40&energy.deficit>=10+variable.ssw_refund
actions.stealth_cds+=/shadow_dance,if=combo_points<=1

# Stealthed Rotation
actions.stealthed=symbols_of_death,if=(buff.symbols_of_death.remains<target.time_to_die-4&buff.symbols_of_death.remains<=buff.symbols_of_death.duration*0.3)|equipped.shadow_satyrs_walk&energy.time_to_max<0.25
actions.stealthed+=/call_action_list,name=finish,if=combo_points>=5
actions.stealthed+=/shuriken_storm,if=buff.shadowmeld.down&((combo_points.deficit>=3&spell_targets.shuriken_storm>=2+talent.premeditation.enabled+equipped.shadow_satyrs_walk)|buff.the_dreadlords_deceit.stack>=29)
actions.stealthed+=/shadowstrike

head=cowl_of_fright,id=139205,bonus_id=1805/43/1507/3337
neck=sea_fan_pendant,id=142428,bonus_id=3507/1497,enchant=mark_of_the_hidden_satyr
shoulders=steelgazer_hide_mantle,id=134154,bonus_id=3417/43/1542/3337
back=drape_of_the_manastarved,id=141543,bonus_id=1808/1487/3337,gems=200agi,enchant=200agi
chest=biornskin_vest,id=134197,bonus_id=3417/1552/3337
shirt=common_gray_shirt,id=3428
wrists=denial_of_the_halfgiants,id=137100,bonus_id=3459/3458
hands=cruel_vice_grips,id=133617,bonus_id=3510/1537/3337
waist=strand_of_whelk_shells,id=142416,bonus_id=3507/1808/1497,gems=150mastery
legs=legwraps_of_unworthy_souls,id=133616,bonus_id=3418/1532/3337
feet=shadow_satyrs_walk,id=137032,bonus_id=3459/3458
finger1=grubby_silver_ring,id=139236,bonus_id=1806/1808/1502,gems=150vers,enchant=200mastery
finger2=ring_of_collapsing_futures,id=142173,bonus_id=40/3453/1482/3336,enchant=200vers
trinket1=arcanogolem_digit,id=140794,bonus_id=3519
trinket2=draught_of_souls,id=140808,bonus_id=3519
main_hand=fangs_of_the_devourer,id=128476,bonus_id=743,gem_id=139267/142512/139253/0,relic_id=1806:1507:3336/3468:1492/1806:1502/0
off_hand=fangs_of_the_devourer,id=128479

# Gear Summary
# gear_ilvl=891.06
# gear_agility=18504
# gear_stamina=28183
# gear_crit_rating=5349
# gear_haste_rating=4736
# gear_mastery_rating=8343
# gear_versatility_rating=3832
# gear_avoidance_rating=419
# gear_armor=2297

AD+EEF : 572054 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
572054.4 572054.4 679.5 / 0.119% 96419.8 / 16.9% 19616.2
RPS Out RPS In Primary Resource Waiting APM Active Skill
29.1 29.1 Energy 22.54% 56.9 100.0% 100%
Origin https://eu.api.battle.net/wow/character/dalaran/Esdeåth/advanced
Talents
  • 15: Master of Subtlety (Subtlety Rogue)
  • 30: Subterfuge
  • 45: Deeper Stratagem
  • 90: Premeditation (Subtlety Rogue)
  • 100: Master of Shadows (Subtlety Rogue)
  • Talent Calculator
Artifact
Professions
  • alchemy: 800
  • enchanting: 133

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
AD+EEF 572054
Arcane Swipe 10622 1.9% 33.2 9.12sec 96242 0 Direct 33.2 77291 154571 96242 24.5% 0.0%  

Stats details: arcane_swipe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 33.21 33.21 0.00 0.00 0.0000 0.0000 3196534.36 3196534.36 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 25.07 75.48% 77290.71 59397 78404 77303.44 74180 78404 1937577 1937577 0.00
crit 8.14 24.52% 154571.31 118793 156807 154551.10 0 156807 1258957 1258957 0.00
 
 

Action details: arcane_swipe

Static Values
  • id:225721
  • school:arcane
  • resource:none
  • range:12.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:225721
  • name:Arcane Swipe
  • school:arcane
  • tooltip:
  • description:{$@spelldesc225127=Your melee attacks have a chance to rake all enemies in front of you for {$225721s1=18328} Arcane damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:48856.63
  • base_dd_max:48856.63
 
auto_attack_mh 10458 1.9% 120.5 2.03sec 26400 16758 Direct 120.5 24991 49978 26400 24.6% 19.0%  

Stats details: auto_attack_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 120.47 120.47 0.00 0.00 1.5753 0.0000 3180329.00 4675384.89 31.98 16758.42 16758.42
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 67.89 56.36% 24990.86 19317 25498 24997.29 24416 25498 1696724 2494345 31.98
crit 29.69 24.64% 49977.76 38633 50996 49991.06 48281 50996 1483605 2181040 31.98
miss 22.89 19.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_mh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
auto_attack_oh 5186 0.9% 119.5 2.04sec 13190 8309 Direct 119.5 12494 24986 13190 24.6% 19.0%  

Stats details: auto_attack_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 119.54 119.54 0.00 0.00 1.5875 0.0000 1576714.04 2317918.99 31.98 8308.60 8308.60
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 67.50 56.47% 12494.20 9658 12749 12497.24 12123 12727 843391 1239865 31.98
crit 29.35 24.55% 24986.12 19317 25498 24994.87 23863 25498 733323 1078054 31.98
miss 22.69 18.98% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_oh

Static Values
  • id:1
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Backstab 29120 5.1% 51.4 5.59sec 171260 170496 Direct 51.4 137407 274855 171265 24.6% 0.0%  

Stats details: backstab

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 51.43 51.43 0.00 0.00 1.0045 0.0000 8807650.24 12948080.14 31.98 170495.95 170495.95
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 38.76 75.37% 137406.75 106732 140886 137442.00 131191 140549 5326092 7829859 31.98
crit 12.67 24.63% 274854.54 213463 281772 274935.81 256156 281772 3481558 5118221 31.98
 
 

Action details: backstab

Static Values
  • id:53
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:53
  • name:Backstab
  • school:physical
  • tooltip:
  • description:Stab the target, causing ${$sw2*$<mult>} Physical damage. Damage increased by {$s4=30}% when you are behind your target. |cFFFFFFFFAwards {$s3=1} combo $lpoint:points;.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.70
 
Collapse 1632 0.3% 5.9 43.72sec 82414 0 Direct 5.9 66466 132883 82419 24.0% 0.0%  

Stats details: collapse

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.89 5.89 0.00 0.00 0.0000 0.0000 485732.71 485732.71 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.48 75.99% 66465.99 50574 66758 66058.70 0 66758 297667 297667 0.00
crit 1.42 24.01% 132882.85 101148 133516 99463.15 0 133516 188066 188066 0.00
 
 

Action details: collapse

Static Values
  • id:234142
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:15.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:234142
  • name:Collapse
  • school:shadow
  • tooltip:
  • description:Deal {$s1=40000} Shadow damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:40000.00
  • base_dd_max:40000.00
 
Eviscerate 176992 30.9% 53.7 5.57sec 987078 982659 Direct 53.7 706382 1413724 987101 39.7% 0.0%  

Stats details: eviscerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 53.74 53.74 0.00 0.00 1.0045 0.0000 53041004.36 77975300.59 31.98 982659.36 982659.36
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 32.41 60.31% 706382.01 432169 1008351 706831.42 639998 783898 22893921 33656233 31.98
crit 21.33 39.69% 1413723.80 864338 2016703 1414732.44 1271798 1750633 30147083 44319068 31.98
 
 

Action details: eviscerate

Static Values
  • id:196819
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.15
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:196819
  • name:Eviscerate
  • school:physical
  • tooltip:
  • description:Finishing move that disembowels the target, causing damage per combo point. 1 point : ${$m1*1} damage 2 points: ${$m1*2} damage 3 points: ${$m1*3} damage 4 points: ${$m1*4} damage 5 points: ${$m1*5} damage{$?s193531=false}[ 6 points: ${$m1*6} damage][]
Weapon
  • normalized:false
  • weapon_power_mod:0.000000
  • weapon_multiplier:0.00
 
Goremaw's Bite 0 (10066) 0.0% (1.8%) 4.6 63.65sec 652333 649445

Stats details: goremaws_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.65 0.00 0.00 0.00 1.0045 0.0000 0.00 0.00 0.00 649445.33 649445.33
 
 

Action details: goremaws_bite

Static Values
  • id:209782
  • school:shadow
  • resource:none
  • range:8.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!stealthed.all&cooldown.shadow_dance.charges_fractional<=2.45&((combo_points.deficit>=4-(time<10)*2&energy.deficit>50+talent.vigor.enabled*25-(time>=10)*15)|target.time_to_die<8)
Spelldata
  • id:209782
  • name:Goremaw's Bite
  • school:physical
  • tooltip:
  • description:Lashes out at the target, inflicting ${$209783sw2+$209784sw2} Shadow damage and reducing movement speed by {$209786s1=60}% for {$209786d=8 seconds}. Grants $220901o2 Energy over {$220901d=6 seconds}. |cFFFFFFFFAwards {$220901s1=3} combo $lpoint:points;.|r
 
    Goremaw's Bite (_mh) 6713 1.2% 4.6 63.65sec 435026 0 Direct 4.6 348443 696247 435076 24.9% 0.0%  

Stats details: goremaws_bite_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.65 4.65 0.00 0.00 0.0000 0.0000 2022144.22 2022144.22 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 3.49 75.10% 348442.63 272066 359127 347928.12 0 359127 1216461 1216461 0.00
crit 1.16 24.90% 696246.60 544132 718254 513055.83 0 718254 805683 805683 0.00
 
 

Action details: goremaws_bite_mh

Static Values
  • id:209783
  • school:shadow
  • resource:none
  • range:8.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:209783
  • name:Goremaw's Bite
  • school:shadow
  • tooltip:
  • description:{$@spelldesc209782=Lashes out at the target, inflicting ${$209783sw2+$209784sw2} Shadow damage and reducing movement speed by {$209786s1=60}% for {$209786d=8 seconds}. Grants $220901o2 Energy over {$220901d=6 seconds}. |cFFFFFFFFAwards {$220901s1=3} combo $lpoint:points;.|r}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:10.00
 
    Goremaw's Bite (_oh) 3353 0.6% 4.6 63.65sec 217307 0 Direct 4.6 174210 348253 217323 24.8% 0.0%  

Stats details: goremaws_bite_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.65 4.65 0.00 0.00 0.0000 0.0000 1010116.01 1010116.01 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 3.50 75.24% 174210.41 136039 179572 173656.61 0 179572 609262 609262 0.00
crit 1.15 24.76% 348253.10 272079 359144 253506.35 0 359144 400854 400854 0.00
 
 

Action details: goremaws_bite_oh

Static Values
  • id:209784
  • school:shadow
  • resource:none
  • range:8.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:209784
  • name:Goremaw's Bite
  • school:shadow
  • tooltip:
  • description:{$@spelldesc209782=Lashes out at the target, inflicting ${$209783sw2+$209784sw2} Shadow damage and reducing movement speed by {$209786s1=60}% for {$209786d=8 seconds}. Grants $220901o2 Energy over {$220901d=6 seconds}. |cFFFFFFFFAwards {$220901s1=3} combo $lpoint:points;.|r}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:10.00
 
Mark of the Hidden Satyr 8951 1.6% 16.5 18.00sec 162852 0 Direct 16.5 130455 260962 162852 24.8% 0.0%  

Stats details: mark_of_the_hidden_satyr

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.54 16.54 0.00 0.00 0.0000 0.0000 2693008.04 2693008.04 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 12.43 75.18% 130455.14 100276 132364 130481.01 124342 132364 1621749 1621749 0.00
crit 4.11 24.82% 260962.18 200552 264729 256721.66 0 264729 1071259 1071259 0.00
 
 

Action details: mark_of_the_hidden_satyr

Static Values
  • id:191259
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191259
  • name:Mark of the Hidden Satyr
  • school:fire
  • tooltip:
  • description:Deals fire damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:2.500000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Nightblade 122111 21.4% 17.1 17.51sec 2154067 2144522 Periodic 144.7 203996 408092 254130 24.6% 0.0% 96.1%

Stats details: nightblade

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.07 0.00 144.71 144.71 1.0045 2.0000 36774256.30 36774256.30 0.00 119955.43 2144521.59
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 109.2 75.44% 203995.88 137013 266408 204045.30 196349 219942 22269068 22269068 0.00
crit 35.5 24.56% 408091.51 274025 532816 408231.13 378505 449212 14505188 14505188 0.00
 
 

Action details: nightblade

Static Values
  • id:195452
  • school:shadow
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:25.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:target.time_to_die>8&((refreshable&(!finality|buff.finality_nightblade.up))|remains<tick_time)
Spelldata
  • id:195452
  • name:Nightblade
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec and snared by attacks.
  • description:Finishing move that infects the target with shadowy energy, dealing Shadow damage over time and causing attacks against the target to reduce movement speed by {$206760s1=30}% for {$206760d=8 seconds}. Lasts longer per combo point. 1 point : ${$m1*8/2} over 8 sec 2 points: ${$m1*10/2} over 10 sec 3 points: ${$m1*12/2} over 12 sec 4 points: ${$m1*14/2} over 14 sec 5 points: ${$m1*16/2} over 16 sec{$?s193531=false}[ 6 points: ${$m1*18/2} over 18 sec][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:1.380000
  • spell_power_mod.tick:0.000000
  • base_td:1.00
  • dot_duration:6.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Potion of the Old War 18895 3.3% 23.4 8.06sec 238859 0 Direct 23.4 191615 383244 238857 24.7% 0.0%  

Stats details: potion_of_the_old_war

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.37 23.37 0.00 0.00 0.0000 0.0000 5583145.13 8207752.19 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.61 75.35% 191615.40 146122 192882 191611.26 179438 192882 3374676 4961094 31.98
crit 5.76 24.65% 383244.48 292245 385763 382455.44 0 385763 2208469 3246658 31.91
 
 

Action details: potion_of_the_old_war

Static Values
  • id:188028
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188028
  • name:Potion of the Old War
  • school:physical
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:135920.00
  • base_dd_max:203880.00
 
Shadow Blades 0 (15855) 0.0% (2.7%) 2.1 180.19sec 2237569 0

Stats details: shadow_blades

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.10 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: shadow_blades

Static Values
  • id:121471
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:combo_points<=2|(equipped.denial_of_the_halfgiants&combo_points>=1)
Spelldata
  • id:121471
  • name:Shadow Blades
  • school:physical
  • tooltip:Autoattacks deal pure Shadow damage. Combo-point-generating attacks generate {$s2=1} additional combo point.
  • description:Draws upon surrounding shadows to empower your weapons, causing auto attacks to deal Shadow damage and abilities that generate combo points to generate 1 additional combo point. Lasts {$d=15 seconds}.
 
    Shadow Blade (_mh) 10569 1.8% 67.4 3.57sec 46415 32313 Direct 67.4 37210 74419 46416 24.7% 0.0%  

Stats details: shadow_blade_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 67.37 67.37 0.00 0.00 1.4364 0.0000 3127169.08 3127169.08 0.00 32313.48 32313.48
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 50.71 75.26% 37209.88 28397 37484 37207.67 36348 37484 1886767 1886767 0.00
crit 16.67 24.74% 74419.43 56794 74969 74413.95 71182 74969 1240402 1240402 0.00
 
 

Action details: shadow_blade_mh

Static Values
  • id:121473
  • school:shadow
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:121473
  • name:Shadow Blade
  • school:shadow
  • tooltip:
  • description:Strike with dark energy, dealing Shadow damage equal to {$s1=1}% weapon damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
    Shadow Blade Off-hand 5286 0.9% 67.4 3.57sec 23216 16163 Direct 67.4 18605 37212 23217 24.8% 0.0%  

Stats details: shadow_blade_offhand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 67.37 67.37 0.00 0.00 1.4364 0.0000 1564162.20 1564162.20 0.00 16162.87 16162.87
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 50.68 75.22% 18604.56 14199 18742 18603.49 18120 18742 942798 942798 0.00
crit 16.70 24.78% 37212.04 28397 37484 37209.76 35922 37484 621364 621364 0.00
 
 

Action details: shadow_blade_offhand

Static Values
  • id:121474
  • school:shadow
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:121474
  • name:Shadow Blade Off-hand
  • school:shadow
  • tooltip:
  • description:Strike with dark energy, dealing Shadow damage equal to {$s1=1}% weapon damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Shadow Nova 11088 1.9% 32.3 9.53sec 102960 0 Direct 32.3 82591 165178 102958 24.7% 0.0%  

Stats details: shadow_nova

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 32.32 32.32 0.00 0.00 0.0000 0.0000 3327600.20 3327600.20 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 24.35 75.34% 82591.00 68830 82595 82591.21 81907 82595 2010964 2010964 0.00
crit 7.97 24.66% 165178.38 137659 165191 165179.86 160602 165191 1316636 1316636 0.00
 
 

Action details: shadow_nova

Static Values
  • id:197800
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:5.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:197800
  • name:Shadow Nova
  • school:shadow
  • tooltip:
  • description:Deals {$s1=0} Shadow damage to enemies with $A1 yards.
 
Shadowstrike 122561 (151079) 21.4% (26.4%) 105.4 2.87sec 430066 428141 Direct 105.4 260253 520522 348865 34.0% 0.0%  

Stats details: shadowstrike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 105.36 105.36 0.00 0.00 1.0045 0.0000 36754949.75 54033257.65 31.98 428140.61 428140.61
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 69.49 65.95% 260253.26 216893 260271 260253.99 258385 260271 18083722 26584784 31.98
crit 35.87 34.05% 520522.38 433785 520542 520522.72 514559 520542 18671228 27448474 31.98
 
 

Action details: shadowstrike

Static Values
  • id:185438
  • school:physical
  • resource:energy
  • range:15.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:185438
  • name:Shadowstrike
  • school:physical
  • tooltip:
  • description:Strike through the shadows, $?a231718[appearing behind your target and ][]dealing $sw2 Physical damage. |cFFFFFFFFAwards {$s3=1} combo $lpoint:points;.|r
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:8.50
 
    Soul Rip 28518 5.0% 104.8 2.85sec 81654 0 Direct 104.8 65553 131106 81656 24.6% 0.0%  

Stats details: soul_rip

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 104.77 104.77 0.00 0.00 0.0000 0.0000 8554742.92 8554742.92 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 79.04 75.44% 65553.23 65553 65553 65553.23 65553 65553 5181013 5181013 0.00
crit 25.73 24.56% 131106.47 131106 131106 131106.47 131106 131106 3373730 3373730 0.00
 
 

Action details: soul_rip

Static Values
  • id:220893
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:220893
  • name:Soul Rip
  • school:shadow
  • tooltip:
  • description:{$@spelldesc209835=After using Shadowstrike or Cheap Shot, Akaari's Soul appears $m1 sec later and Soul Rips your target, dealing {$220893s1=1} Shadow damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:1.500000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Simple Action Stats Execute Interval
AD+EEF
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:AD+EEF
  • harmful:false
  • if_expr:
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:AD+EEF
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:AD+EEF
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Shadow Dance 26.4 11.46sec

Stats details: shadow_dance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 26.38 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: shadow_dance

Static Values
  • id:185313
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:charges_fractional>=2.45
Spelldata
  • id:185313
  • name:Shadow Dance
  • school:physical
  • tooltip:
  • description:Allows use of all Stealth abilities and grants all the combat benefits of Stealth for {$d=3 seconds}. Effect not broken from taking damage or attacking. {$?s14062=false}[Movement speed while active is increased by {$1784s3=0}% and damage dealt is increased by {$1784s4=0}%. ]?s108209[Abilities cost {$112942s1=75}% less while active. ][]{$?s31223=false}[Attacks from Shadow Dance and for {$31223s1=5} sec after deal {$31665s1=10}% more damage. ][]
 
Sprint 2.7 122.24sec

Stats details: sprint

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.74 0.00 86.76 0.00 0.0000 0.2500 0.00 0.00 0.00 0.00 0.00
 
 

Action details: sprint

Static Values
  • id:2983
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:2983
  • name:Sprint
  • school:physical
  • tooltip:Movement speed increased by $w1%.
  • description:Increases your movement speed by {$s1=70}% for {$d=8 seconds}. Usable while stealthed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:0.25
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Symbols of Death 13.3 23.84sec

Stats details: symbols_of_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.32 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: symbols_of_death

Static Values
  • id:212283
  • school:physical
  • resource:energy
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:10.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:212283
  • name:Symbols of Death
  • school:physical
  • tooltip:All damage done increased by {$s1=20}%.
  • description:Invoke ancient symbols of power, increasing all damage you deal by {$s1=20}% for {$d=35 seconds}, and causing your next Shadowstrike to critically strike. Unaffected by the global cooldown.
 
Vanish 2.8 122.17sec

Stats details: vanish

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.85 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: vanish

Static Values
  • id:1856
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:1856
  • name:Vanish
  • school:physical
  • tooltip:Improved stealth.
  • description:Allows you to vanish from sight, entering stealth while in combat. For the first {$11327d=3 seconds} after vanishing, damage and harmful effects received will not break stealth. Also breaks movement impairing effects.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Arcane Enchant 1.2 0.1 105.8sec 87.1sec 8.06% 8.06% 0.1(0.1) 1.1

Buff details

  • buff initial source:AD+EEF
  • cooldown name:buff_arcane_enchant
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:4828.95

Stack Uptimes

  • arcane_enchant_1:8.06%

Trigger Attempt Success

  • trigger_pct:74.23%

Spelldata details

  • id:225730
  • name:Arcane Enchant
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc225129=Your melee and ranged attacks have a chance to grant you a Fiery, Frost, or Arcane enchant for {$225726d=20 seconds}. }
  • max_stacks:0
  • duration:20.00
  • cooldown:1.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 26.34% 0.0(0.0) 1.0

Buff details

  • buff initial source:AD+EEF
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Death 13.3 0.0 22.7sec 23.8sec 1.49% 12.48% 0.0(0.0) 0.2

Buff details

  • buff initial source:AD+EEF
  • cooldown name:buff_death
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • death_1:1.49%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:227151
  • name:Death
  • tooltip:Your next Shadowstrike will critically strike.
  • description:{$@spelldesc212283=Invoke ancient symbols of power, increasing all damage you deal by {$s1=20}% for {$d=35 seconds}, and causing your next Shadowstrike to critically strike. Unaffected by the global cooldown.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Faster Than Light Trigger 2.7 0.0 122.3sec 122.3sec 2.72% 2.72% 0.0(0.0) 2.7

Buff details

  • buff initial source:AD+EEF
  • cooldown name:buff_faster_than_light_trigger
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • faster_than_light_trigger_1:2.72%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:197270
  • name:Faster Than Light Trigger
  • tooltip:
  • description:
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
Fiery Enchant 1.2 0.1 104.7sec 87.2sec 7.96% 7.96% 0.1(0.1) 1.1

Buff details

  • buff initial source:AD+EEF
  • cooldown name:buff_fiery_enchant
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:4828.95

Stack Uptimes

  • fiery_enchant_1:7.96%

Trigger Attempt Success

  • trigger_pct:74.01%

Spelldata details

  • id:225726
  • name:Fiery Enchant
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc225129=Your melee and ranged attacks have a chance to grant you a Fiery, Frost, or Arcane enchant for {$225726d=20 seconds}. }
  • max_stacks:0
  • duration:20.00
  • cooldown:1.00
  • default_chance:0.00%
Finality: Eviscerate 27.1 0.0 11.1sec 11.1sec 48.86% 49.53% 0.0(0.0) 0.0

Buff details

  • buff initial source:AD+EEF
  • cooldown name:buff_finality_eviscerate
  • max_stacks:10
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.04

Stack Uptimes

  • finality_eviscerate_5:22.56%
  • finality_eviscerate_6:26.29%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:197496
  • name:Finality: Eviscerate
  • tooltip:Your next Eviscerate will do $w1% increased damage.
  • description:
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Finality: Nightblade 8.7 0.0 35.2sec 35.2sec 42.91% 40.92% 0.0(0.0) 0.0

Buff details

  • buff initial source:AD+EEF
  • cooldown name:buff_finality_nightblade
  • max_stacks:6
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.04

Stack Uptimes

  • finality_nightblade_5:17.47%
  • finality_nightblade_6:25.44%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:197498
  • name:Finality: Nightblade
  • tooltip:Your next Nightblade will do $w1% increased damage.
  • description:
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Frost Enchant 1.2 0.1 105.3sec 87.1sec 8.01% 8.01% 0.1(0.1) 1.1

Buff details

  • buff initial source:AD+EEF
  • cooldown name:buff_frost_enchant
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:4828.95

Stack Uptimes

  • frost_enchant_1:8.01%

Trigger Attempt Success

  • trigger_pct:73.83%

Spelldata details

  • id:225729
  • name:Frost Enchant
  • tooltip:Mastery increased by $w1.
  • description:{$@spelldesc225129=Your melee and ranged attacks have a chance to grant you a Fiery, Frost, or Arcane enchant for {$225726d=20 seconds}. }
  • max_stacks:0
  • duration:20.00
  • cooldown:1.00
  • default_chance:0.00%
Goremaw's Bite 4.6 0.0 63.5sec 63.5sec 9.15% 9.15% 27.5(27.5) 4.5

Buff details

  • buff initial source:AD+EEF
  • cooldown name:buff_goremaws_bite
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • goremaws_bite_1:9.15%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:220901
  • name:Goremaw's Bite
  • tooltip:Generating {$s2=5} Energy every $t2 sec.
  • description:{$@spelldesc209782=Lashes out at the target, inflicting ${$209783sw2+$209784sw2} Shadow damage and reducing movement speed by {$209786s1=60}% for {$209786d=8 seconds}. Grants $220901o2 Energy over {$220901d=6 seconds}. |cFFFFFFFFAwards {$220901s1=3} combo $lpoint:points;.|r}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Master of Subtlety 37.0 1.4 8.2sec 7.9sec 34.70% 46.12% 1.4(1.4) 12.7

Buff details

  • buff initial source:AD+EEF
  • cooldown name:buff_master_of_subtlety
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • master_of_subtlety_1:34.70%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:31223
  • name:Master of Subtlety
  • tooltip:
  • description:Attacks made while stealthed and for {$s1=5} seconds after breaking stealth cause an additional {$31665s1=10}% damage.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Master of Subtlety (_aura) 37.1 1.4 8.2sec 8.0sec 48.69% 36.38% 1.4(1.4) 0.0

Buff details

  • buff initial source:AD+EEF
  • cooldown name:buff_master_of_subtlety_aura
  • max_stacks:1
  • duration:150.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • master_of_subtlety_aura_1:48.69%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:31223
  • name:Master of Subtlety
  • tooltip:
  • description:Attacks made while stealthed and for {$s1=5} seconds after breaking stealth cause an additional {$31665s1=10}% damage.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of the Old War 2.0 0.0 149.7sec 0.0sec 16.24% 16.24% 0.0(0.0) 2.0

Buff details

  • buff initial source:AD+EEF
  • cooldown name:buff_potion_of_the_old_war
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_the_old_war_1:16.24%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188028
  • name:Potion of the Old War
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Shadow Blades 2.1 0.0 180.2sec 180.2sec 34.76% 39.84% 0.0(0.0) 2.0

Buff details

  • buff initial source:AD+EEF
  • cooldown name:buff_shadow_blades
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • shadow_blades_1:34.76%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:121471
  • name:Shadow Blades
  • tooltip:Autoattacks deal pure Shadow damage. Combo-point-generating attacks generate {$s2=1} additional combo point.
  • description:Draws upon surrounding shadows to empower your weapons, causing auto attacks to deal Shadow damage and abilities that generate combo points to generate 1 additional combo point. Lasts {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Shadow Dance 26.4 0.0 11.4sec 11.4sec 43.66% 43.66% 0.0(0.0) 26.0

Buff details

  • buff initial source:AD+EEF
  • cooldown name:buff_shadow_dance
  • max_stacks:1
  • duration:5.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • shadow_dance_1:43.66%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:185313
  • name:Shadow Dance
  • tooltip:
  • description:Allows use of all Stealth abilities and grants all the combat benefits of Stealth for {$d=3 seconds}. Effect not broken from taking damage or attacking. {$?s14062=false}[Movement speed while active is increased by {$1784s3=0}% and damage dealt is increased by {$1784s4=0}%. ]?s108209[Abilities cost {$112942s1=75}% less while active. ][]{$?s31223=false}[Attacks from Shadow Dance and for {$31223s1=5} sec after deal {$31665s1=10}% more damage. ][]
  • max_stacks:0
  • duration:3.00
  • cooldown:1.00
  • default_chance:0.00%
Sprint 2.7 0.0 122.3sec 122.3sec 7.20% 7.20% 86.8(86.8) 2.7

Buff details

  • buff initial source:AD+EEF
  • cooldown name:buff_sprint
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • sprint_1:7.20%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2983
  • name:Sprint
  • tooltip:Movement speed increased by $w1%.
  • description:Increases your movement speed by {$s1=70}% for {$d=8 seconds}. Usable while stealthed.
  • max_stacks:0
  • duration:8.00
  • cooldown:120.00
  • default_chance:0.00%
Stealth 6.5 0.0 44.9sec 52.1sec 1.03% 1.03% 0.0(0.0) 0.0

Buff details

  • buff initial source:AD+EEF
  • cooldown name:buff_stealth
  • max_stacks:1
  • duration:150.00
  • cooldown:2.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stealth_1:1.03%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:1784
  • name:Stealth
  • tooltip:Stealthed.$?$w3!=0[ Movement speed increased by $w3%.][]$?$w4!=0[ Damage increased by $w4%.][]
  • description:Conceals you in the shadows until cancelled, allowing you to stalk enemies without being seen. {$?s14062=false}[Movement speed while stealthed is increased by {$s3=0}% and damage dealt is increased by {$s4=0}%.]?s108209[ Abilities cost {$112942s1=75}% less while stealthed. ][]{$?s31223=false}[ Attacks from Stealth and for {$31223s1=5} sec after deal {$31665s1=10}% more damage.][]
  • max_stacks:0
  • duration:-0.00
  • cooldown:2.00
  • default_chance:100.00%
Subterfuge 6.6 0.0 44.6sec 52.2sec 6.55% 6.55% 0.0(0.0) 6.5

Buff details

  • buff initial source:AD+EEF
  • cooldown name:buff_subterfuge
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • subterfuge_1:6.55%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:115192
  • name:Subterfuge
  • tooltip:Temporarily concealed in the shadows.
  • description:{$@spelldesc108208=Your abilities requiring Stealth can still be used for {$115192d=3 seconds} after Stealth breaks.$?c3[ Also increases the duration of Shadow Dance by ${$m2/1000} sec.][ Also causes Garrote to deal {$115192s2=125}% increased damage and have no cooldown when used from Stealth or {$115192d=3 seconds} after Stealth breaks.]}
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
Symbols of Death 1.2 12.1 188.6sec 23.8sec 99.79% 99.32% 12.1(12.1) 0.2

Buff details

  • buff initial source:AD+EEF
  • cooldown name:buff_symbols_of_death
  • max_stacks:1
  • duration:35.00
  • cooldown:10.00
  • default_chance:100.00%
  • default_value:1.20

Stack Uptimes

  • symbols_of_death_1:99.79%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:212283
  • name:Symbols of Death
  • tooltip:All damage done increased by {$s1=20}%.
  • description:Invoke ancient symbols of power, increasing all damage you deal by {$s1=20}% for {$d=35 seconds}, and causing your next Shadowstrike to critically strike. Unaffected by the global cooldown.
  • max_stacks:0
  • duration:35.00
  • cooldown:10.00
  • default_chance:0.00%
Temptation 1.9 4.0 176.7sec 43.4sec 37.06% 67.02% 0.0(0.0) 1.4

Buff details

  • buff initial source:AD+EEF
  • cooldown name:buff_temptation
  • max_stacks:10
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • temptation_1:9.76%
  • temptation_2:9.86%
  • temptation_3:9.39%
  • temptation_4:7.84%
  • temptation_5:0.22%
  • temptation_6:0.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:234143
  • name:Temptation
  • tooltip:Increased chance for your Ring of Collapsing Futures to incur a {$s1=5} min cooldown.
  • description:{$@spelldesc234142=Deal {$s1=40000} Shadow damage to an enemy.}
  • max_stacks:10
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Vanish 5.6 0.0 52.0sec 52.0sec 5.53% 5.53% 0.0(0.0) 5.5

Buff details

  • buff initial source:AD+EEF
  • cooldown name:buff_vanish
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • vanish_1:5.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:11327
  • name:Vanish
  • tooltip:Improved stealth.$?$w3!=0[ Movement speed increased by $w3%.][]$?$w4!=0[ Damage increased by $w4%.][]
  • description:
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:AD+EEF
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Seventh Demon

Buff details

  • buff initial source:AD+EEF
  • cooldown name:buff_flask_of_the_seventh_demon
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:1300.00

Stack Uptimes

  • flask_of_the_seventh_demon_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188033
  • name:Flask of the Seventh Demon
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (seedbattered_fish_plate)

Buff details

  • buff initial source:AD+EEF
  • cooldown name:buff_seedbattered_fish_plate
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:versatility_rating
  • amount:375.00

Stack Uptimes

  • seedbattered_fish_plate_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225605
  • name:Well Fed
  • tooltip:Versatility increased by $w1.
  • description:Increases versatility by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
AD+EEF
backstab Energy 51.4 1799.9 35.0 35.0 4893.4
eviscerate Energy 53.7 1880.8 35.0 35.0 28202.0
eviscerate Combo Points 53.7 299.2 5.6 5.6 177250.8
nightblade Energy 17.1 426.8 25.0 25.0 86161.9
nightblade Combo Points 17.1 95.2 5.6 5.6 386224.7
shadowstrike Energy 105.4 4214.3 40.0 40.0 10751.4
symbols_of_death Energy 13.3 431.2 32.4 32.4 0.0
Resource Gains Type Count Total Average Overflow
backstab Combo Points 51.43 51.43 (12.94%) 1.00 0.00 0.00%
goremaws_bite Combo Points 4.65 13.78 (3.47%) 2.96 0.16 1.18%
shadowstrike Combo Points 105.36 210.71 (53.04%) 2.00 0.00 0.00%
energy_regen Energy 1179.52 3369.95 (38.77%) 2.86 94.39 2.72%
Shadow Techniques Combo Points 72.78 71.90 (18.10%) 0.99 15.46 17.69%
Master of Shadows Energy 37.49 789.80 (9.09%) 21.07 147.39 15.73%
Shadow Blades Combo Points 59.18 49.46 (12.45%) 0.84 9.72 16.42%
Energetic Stabbing Energy 26.40 659.89 (7.59%) 25.00 0.00 0.00%
Goremaw's Bite Energy 27.52 134.67 (1.55%) 4.89 2.96 2.15%
Relentless Strikes Energy 70.81 3106.39 (35.74%) 43.87 49.69 1.57%
Shadow Satyr's Walk Energy 105.36 632.14 (7.27%) 6.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Energy 28.85 29.05
Combo Points 1.32 1.31
Combat End Resource Mean Min Max
Energy 41.11 6.45 100.00
Combo Points 2.79 0.00 6.00

Benefits & Uptimes

Benefits %
Uptimes %
Energy Cap 1.5%

Statistics & Data Analysis

Fight Length
Sample Data AD+EEF Fight Length
Count 4999
Mean 301.28
Minimum 222.03
Maximum 381.32
Spread ( max - min ) 159.29
Range [ ( max - min ) / 2 * 100% ] 26.44%
DPS
Sample Data AD+EEF Damage Per Second
Count 4999
Mean 572054.39
Minimum 502601.04
Maximum 659645.15
Spread ( max - min ) 157044.11
Range [ ( max - min ) / 2 * 100% ] 13.73%
Standard Deviation 24513.5115
5th Percentile 533736.66
95th Percentile 613481.37
( 95th Percentile - 5th Percentile ) 79744.71
Mean Distribution
Standard Deviation 346.7081
95.00% Confidence Intervall ( 571374.86 - 572733.93 )
Normalized 95.00% Confidence Intervall ( 99.88% - 100.12% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 71
0.1% Error 7054
0.1 Scale Factor Error with Delta=300 5129733
0.05 Scale Factor Error with Delta=300 20518931
0.01 Scale Factor Error with Delta=300 512973257
Priority Target DPS
Sample Data AD+EEF Priority Target Damage Per Second
Count 4999
Mean 572054.39
Minimum 502601.04
Maximum 659645.15
Spread ( max - min ) 157044.11
Range [ ( max - min ) / 2 * 100% ] 13.73%
Standard Deviation 24513.5115
5th Percentile 533736.66
95th Percentile 613481.37
( 95th Percentile - 5th Percentile ) 79744.71
Mean Distribution
Standard Deviation 346.7081
95.00% Confidence Intervall ( 571374.86 - 572733.93 )
Normalized 95.00% Confidence Intervall ( 99.88% - 100.12% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 71
0.1% Error 7054
0.1 Scale Factor Error with Delta=300 5129733
0.05 Scale Factor Error with Delta=300 20518931
0.01 Scale Factor Error with Delta=300 512973257
DPS(e)
Sample Data AD+EEF Damage Per Second (Effective)
Count 4999
Mean 572054.39
Minimum 502601.04
Maximum 659645.15
Spread ( max - min ) 157044.11
Range [ ( max - min ) / 2 * 100% ] 13.73%
Damage
Sample Data AD+EEF Damage
Count 4999
Mean 171699258.57
Minimum 128344336.63
Maximum 220242912.28
Spread ( max - min ) 91898575.66
Range [ ( max - min ) / 2 * 100% ] 26.76%
DTPS
Sample Data AD+EEF Damage Taken Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data AD+EEF Healing Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data AD+EEF Healing Per Second (Effective)
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data AD+EEF Heal
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data AD+EEF Healing Taken Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data AD+EEF Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data AD+EEFTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data AD+EEF Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,name=flask_of_the_seventh_demon
1 0.00 augmentation,name=defiled
2 0.00 food,name=seedbattered_fish_plate
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 stealth
5 0.00 potion,name=old_war
6 0.00 marked_for_death,if=raid_event.adds.in>40
7 0.00 variable,name=ssw_refund,value=equipped.shadow_satyrs_walk*(4+ssw_refund_offset)
Defined variables that doesn't change during the fight
8 0.00 variable,name=stealth_threshold,value=(15+talent.vigor.enabled*35+talent.master_of_shadows.enabled*30+variable.ssw_refund)
9 0.00 enveloping_shadows,if=combo_points>=5
A 0.00 symbols_of_death
Default action list Executed every time the actor is available.
# count action,conditions
B 0.00 call_action_list,name=cds
C 0.00 run_action_list,name=stealthed,if=stealthed.all
Fully switch to the Stealthed Rotation (by doing so, it forces pooling if nothing is available)
D 0.00 call_action_list,name=finish,if=combo_points>=5|(combo_points>=4&spell_targets.shuriken_storm>=3&spell_targets.shuriken_storm<=4)
E 0.00 call_action_list,name=stealth_als,if=combo_points.deficit>=2+talent.premeditation.enabled
F 0.00 call_action_list,name=build,if=energy.deficit<=variable.stealth_threshold
actions.build Builders
# count action,conditions
0.00 shuriken_storm,if=spell_targets.shuriken_storm>=2
0.00 gloomblade
G 51.43 backstab
actions.cds Cooldowns
# count action,conditions
H 1.00 potion,name=old_war,if=buff.bloodlust.react|target.time_to_die<=25|buff.shadow_blades.up
I 5.89 use_item,slot=finger2,if=(buff.shadow_blades.up&stealthed.rogue)|target.time_to_die<20
0.00 blood_fury,if=stealthed.rogue
0.00 berserking,if=stealthed.rogue
0.00 arcane_torrent,if=stealthed.rogue&energy.deficit>70
J 2.10 shadow_blades,if=combo_points<=2|(equipped.denial_of_the_halfgiants&combo_points>=1)
K 4.65 goremaws_bite,if=!stealthed.all&cooldown.shadow_dance.charges_fractional<=2.45&((combo_points.deficit>=4-(time<10)*2&energy.deficit>50+talent.vigor.enabled*25-(time>=10)*15)|target.time_to_die<8)
0.00 marked_for_death,target_if=min:target.time_to_die,if=target.time_to_die<combo_points.deficit|(raid_event.adds.in>40&combo_points.deficit>=4+talent.deeper_strategem.enabled+talent.anticipation.enabled)
actions.finish Finishers
# count action,conditions
0.00 enveloping_shadows,if=buff.enveloping_shadows.remains<target.time_to_die&buff.enveloping_shadows.remains<=combo_points*1.8
0.00 death_from_above,if=spell_targets.death_from_above>=6
L 17.07 nightblade,cycle_targets=1,if=target.time_to_die>8&((refreshable&(!finality|buff.finality_nightblade.up))|remains<tick_time)
0.00 death_from_above
M 53.74 eviscerate
actions.stealth_cds Stealth Cooldowns
# count action,conditions
R 3.70 shadow_dance,if=charges_fractional>=2.45
S 2.85 vanish
T 2.74 sprint_offensive
U 4.55 shadow_dance,if=charges>=2&combo_points<=1
0.00 pool_resource,for_next=1,extra_amount=40
0.00 shadowmeld,if=energy>=40&energy.deficit>=10+variable.ssw_refund
V 18.13 shadow_dance,if=combo_points<=1
actions.stealthed Stealthed Rotation
# count action,conditions
W 12.32 symbols_of_death,if=(buff.symbols_of_death.remains<target.time_to_die-4&buff.symbols_of_death.remains<=buff.symbols_of_death.duration*0.3)|equipped.shadow_satyrs_walk&energy.time_to_max<0.25
X 0.00 call_action_list,name=finish,if=combo_points>=5
0.00 shuriken_storm,if=buff.shadowmeld.down&((combo_points.deficit>=3&spell_targets.shuriken_storm>=2+talent.premeditation.enabled+equipped.shadow_satyrs_walk)|buff.the_dreadlords_deceit.stack>=29)
Y 105.36 shadowstrike

Sample Sequence

0124578AJIYYLRYYMYYMGGMRWYYLIYYMGSYMWYGMRYMYYMGTGMUIWYYMYYLUYYMYYMGGMUIYYMYYLUYYMYYMVWYYMYYMKGGMVYYLYYMVYYYMGGLVYYYMWGGMVYYYLGGGMGGLVWYYYMKGMVYYYMYSYMYGGLVYYYMTGYYLGGGMVWYYMYGGLJHGGMVYYMYYLKGMVWYYMYGMVYYMYGLGMVYYMWYMGGMVYYLYYMGGGMVYYMYYLGGGMKGGMVWYYLYSYMYGGMVYYMYYLTVWYYYMYYGMGGGM

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask AD+EEF 100.0/100: 100% energy | 0.0/6: 0% combo_points
Pre precombat 1 augmentation AD+EEF 100.0/100: 100% energy | 0.0/6: 0% combo_points
Pre precombat 2 food AD+EEF 100.0/100: 100% energy | 0.0/6: 0% combo_points
Pre precombat 4 stealth Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, stealth
Pre precombat 5 potion Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, stealth, potion_of_the_old_war
Pre precombat 7 ssw_refund Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, stealth, potion_of_the_old_war
Pre precombat 8 stealth_threshold Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, stealth, potion_of_the_old_war
Pre precombat A symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, stealth, symbols_of_death, death, potion_of_the_old_war
0:00.000 cds J shadow_blades Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, stealth, symbols_of_death, death, potion_of_the_old_war
0:00.000 cds I use_item_ring_of_collapsing_futures Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, stealth, symbols_of_death, shadow_blades, death, potion_of_the_old_war
0:00.000 stealthed Y shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points temptation, master_of_subtlety_aura, stealth, symbols_of_death, shadow_blades, death, potion_of_the_old_war
0:01.004 stealthed Y shadowstrike Fluffy_Pillow 80.3/100: 80% energy | 3.0/6: 50% combo_points bloodlust, temptation, master_of_subtlety_aura, stealth, subterfuge, symbols_of_death, shadow_blades, potion_of_the_old_war
0:02.010 finish L nightblade Fluffy_Pillow 60.6/100: 61% energy | 6.0/6: 100% combo_points bloodlust, temptation, master_of_subtlety_aura, stealth, subterfuge, symbols_of_death, shadow_blades, potion_of_the_old_war
0:03.017 stealth_cds R shadow_dance Fluffy_Pillow 90.0/100: 90% energy | 0.0/6: 0% combo_points bloodlust, temptation, master_of_subtlety, symbols_of_death, shadow_blades, finality_nightblade(6), potion_of_the_old_war
0:03.017 stealthed Y shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points bloodlust, temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6), potion_of_the_old_war
0:04.021 stealthed Y shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 4.0/6: 67% combo_points bloodlust, temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6), potion_of_the_old_war
0:05.025 finish M eviscerate Fluffy_Pillow 100.0/100: 100% energy | 6.0/6: 100% combo_points bloodlust, temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6), potion_of_the_old_war
0:06.029 stealthed Y shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points bloodlust, temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6), potion_of_the_old_war
0:07.033 stealthed Y shadowstrike Fluffy_Pillow 80.3/100: 80% energy | 4.0/6: 67% combo_points bloodlust, temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6), potion_of_the_old_war
0:08.037 finish M eviscerate Fluffy_Pillow 60.6/100: 61% energy | 6.0/6: 100% combo_points bloodlust, temptation, master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6), potion_of_the_old_war
0:09.040 build G backstab Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points bloodlust, temptation, master_of_subtlety, symbols_of_death, shadow_blades, finality_nightblade(6), potion_of_the_old_war
0:10.047 build G backstab Fluffy_Pillow 79.3/100: 79% energy | 4.0/6: 67% combo_points bloodlust, temptation, master_of_subtlety, symbols_of_death, shadow_blades, finality_nightblade(6), potion_of_the_old_war
0:11.051 finish M eviscerate Fluffy_Pillow 58.6/100: 59% energy | 6.0/6: 100% combo_points bloodlust, temptation, master_of_subtlety, symbols_of_death, shadow_blades, finality_nightblade(6), potion_of_the_old_war
0:12.054 stealth_cds R shadow_dance Fluffy_Pillow 77.9/100: 78% energy | 1.0/6: 17% combo_points bloodlust, temptation, master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6), potion_of_the_old_war
0:12.054 stealthed W symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points bloodlust, temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6), potion_of_the_old_war
0:12.054 stealthed Y shadowstrike Fluffy_Pillow 65.0/100: 65% energy | 1.0/6: 17% combo_points bloodlust, temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, death, finality_eviscerate(6), finality_nightblade(6), potion_of_the_old_war
0:13.060 stealthed Y shadowstrike Fluffy_Pillow 45.3/100: 45% energy | 4.0/6: 67% combo_points bloodlust, temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6), potion_of_the_old_war
0:14.064 Waiting     0.600 sec 25.6/100: 26% energy | 6.0/6: 100% combo_points bloodlust, temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6), potion_of_the_old_war
0:14.664 finish L nightblade Fluffy_Pillow 34.2/100: 34% energy | 6.0/6: 100% combo_points bloodlust, temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6), potion_of_the_old_war
0:15.668 cds I use_item_ring_of_collapsing_futures Fluffy_Pillow 63.5/100: 63% energy | 0.0/6: 0% combo_points bloodlust, temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), potion_of_the_old_war
0:15.668 stealthed Y shadowstrike Fluffy_Pillow 63.5/100: 63% energy | 0.0/6: 0% combo_points bloodlust, temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), potion_of_the_old_war
0:16.673 stealthed Y shadowstrike Fluffy_Pillow 43.8/100: 44% energy | 4.0/6: 67% combo_points bloodlust, temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), potion_of_the_old_war
0:17.677 Waiting     0.800 sec 24.1/100: 24% energy | 6.0/6: 100% combo_points bloodlust, temptation(2), master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), potion_of_the_old_war
0:18.477 finish M eviscerate Fluffy_Pillow 35.5/100: 35% energy | 6.0/6: 100% combo_points bloodlust, temptation(2), master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), potion_of_the_old_war
0:19.482 build G backstab Fluffy_Pillow 94.8/100: 95% energy | 0.0/6: 0% combo_points bloodlust, temptation(2), master_of_subtlety, symbols_of_death, shadow_blades, potion_of_the_old_war
0:20.488 stealth_cds S vanish Fluffy_Pillow 74.1/100: 74% energy | 3.0/6: 50% combo_points bloodlust, temptation(2), master_of_subtlety, symbols_of_death, shadow_blades, potion_of_the_old_war
0:20.488 stealthed Y shadowstrike Fluffy_Pillow 99.1/100: 99% energy | 3.0/6: 50% combo_points bloodlust, temptation(2), master_of_subtlety_aura, vanish, symbols_of_death, shadow_blades, potion_of_the_old_war
0:21.491 finish M eviscerate Fluffy_Pillow 79.4/100: 79% energy | 6.0/6: 100% combo_points bloodlust, temptation(2), master_of_subtlety_aura, vanish, subterfuge, symbols_of_death, shadow_blades, potion_of_the_old_war
0:22.495 stealthed W symbols_of_death Fluffy_Pillow 98.7/100: 99% energy | 0.0/6: 0% combo_points bloodlust, temptation(2), master_of_subtlety_aura, vanish, subterfuge, symbols_of_death, shadow_blades, finality_eviscerate(6), potion_of_the_old_war
0:22.495 stealthed Y shadowstrike Fluffy_Pillow 63.7/100: 64% energy | 0.0/6: 0% combo_points bloodlust, temptation(2), master_of_subtlety_aura, vanish, subterfuge, symbols_of_death, shadow_blades, death, finality_eviscerate(6), potion_of_the_old_war
0:23.499 build G backstab Fluffy_Pillow 94.0/100: 94% energy | 4.0/6: 67% combo_points bloodlust, temptation(2), master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6)
0:24.502 finish M eviscerate Fluffy_Pillow 73.3/100: 73% energy | 6.0/6: 100% combo_points bloodlust, temptation(2), master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6)
0:25.506 stealth_cds R shadow_dance Fluffy_Pillow 92.6/100: 93% energy | 0.0/6: 0% combo_points bloodlust, temptation(2), master_of_subtlety, symbols_of_death, shadow_blades
0:25.506 stealthed Y shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points bloodlust, temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades
0:26.510 finish M eviscerate Fluffy_Pillow 80.3/100: 80% energy | 5.0/6: 83% combo_points bloodlust, temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades
0:27.514 stealthed Y shadowstrike Fluffy_Pillow 99.6/100: 100% energy | 0.0/6: 0% combo_points bloodlust, temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(5)
0:28.520 stealthed Y shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 4.0/6: 67% combo_points bloodlust, temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(5)
0:29.524 finish M eviscerate Fluffy_Pillow 100.0/100: 100% energy | 6.0/6: 100% combo_points bloodlust, temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(5)
0:30.527 build G backstab Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points bloodlust, temptation(2), master_of_subtlety, symbols_of_death, shadow_blades
0:31.532 stealth_cds T sprint Fluffy_Pillow 79.3/100: 79% energy | 3.0/6: 50% combo_points bloodlust, temptation(2), master_of_subtlety, symbols_of_death, shadow_blades
0:31.532 build G backstab Fluffy_Pillow 79.3/100: 79% energy | 3.0/6: 50% combo_points bloodlust, temptation(2), master_of_subtlety, sprint, symbols_of_death, shadow_blades, faster_than_light_trigger
0:32.536 finish M eviscerate Fluffy_Pillow 58.6/100: 59% energy | 5.0/6: 83% combo_points bloodlust, temptation(2), master_of_subtlety, sprint, symbols_of_death, shadow_blades, faster_than_light_trigger
0:33.540 stealth_cds U shadow_dance Fluffy_Pillow 77.9/100: 78% energy | 0.0/6: 0% combo_points bloodlust, temptation(2), master_of_subtlety, sprint, symbols_of_death, shadow_blades, finality_eviscerate(5), faster_than_light_trigger
0:33.540 cds I use_item_ring_of_collapsing_futures Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points bloodlust, temptation(2), master_of_subtlety_aura, shadow_dance, sprint, symbols_of_death, shadow_blades, finality_eviscerate(5), faster_than_light_trigger
0:33.540 stealthed W symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points bloodlust, temptation(3), master_of_subtlety_aura, shadow_dance, sprint, symbols_of_death, shadow_blades, finality_eviscerate(5), faster_than_light_trigger
0:33.540 stealthed Y shadowstrike Fluffy_Pillow 65.0/100: 65% energy | 0.0/6: 0% combo_points bloodlust, temptation(3), master_of_subtlety_aura, shadow_dance, sprint, symbols_of_death, shadow_blades, death, finality_eviscerate(5), faster_than_light_trigger
0:34.544 stealthed Y shadowstrike Fluffy_Pillow 70.3/100: 70% energy | 3.0/6: 50% combo_points bloodlust, temptation(3), master_of_subtlety_aura, shadow_dance, vanish, subterfuge, sprint, symbols_of_death, shadow_blades, finality_eviscerate(5)
0:35.550 finish M eviscerate Fluffy_Pillow 50.6/100: 51% energy | 6.0/6: 100% combo_points bloodlust, temptation(3), master_of_subtlety_aura, shadow_dance, vanish, subterfuge, sprint, symbols_of_death, shadow_blades, finality_eviscerate(5)
0:36.554 stealthed Y shadowstrike Fluffy_Pillow 69.9/100: 70% energy | 1.0/6: 17% combo_points bloodlust, temptation(3), master_of_subtlety_aura, shadow_dance, vanish, subterfuge, sprint, symbols_of_death, shadow_blades
0:37.558 stealthed Y shadowstrike Fluffy_Pillow 75.2/100: 75% energy | 4.0/6: 67% combo_points bloodlust, temptation(3), master_of_subtlety, shadow_dance, sprint, symbols_of_death, shadow_blades
0:38.563 finish L nightblade Fluffy_Pillow 55.5/100: 56% energy | 6.0/6: 100% combo_points bloodlust, temptation(3), master_of_subtlety, sprint, symbols_of_death, shadow_blades
0:39.568 stealth_cds U shadow_dance Fluffy_Pillow 84.8/100: 85% energy | 0.0/6: 0% combo_points bloodlust, temptation(3), master_of_subtlety, symbols_of_death, shadow_blades, finality_nightblade(6)
0:39.568 stealthed Y shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points bloodlust, temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6)
0:40.573 stealthed Y shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 3.0/6: 50% combo_points bloodlust, temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6)
0:41.578 finish M eviscerate Fluffy_Pillow 77.9/100: 78% energy | 6.0/6: 100% combo_points temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6)
0:42.584 stealthed Y shadowstrike Fluffy_Pillow 93.9/100: 94% energy | 1.0/6: 17% combo_points temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6)
0:43.589 stealthed Y shadowstrike Fluffy_Pillow 95.9/100: 96% energy | 4.0/6: 67% combo_points temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6)
0:44.593 finish M eviscerate Fluffy_Pillow 97.9/100: 98% energy | 6.0/6: 100% combo_points temptation(3), master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6)
0:45.598 build G backstab Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points temptation(3), master_of_subtlety, symbols_of_death, shadow_blades, finality_nightblade(6)
0:46.601 build G backstab Fluffy_Pillow 76.0/100: 76% energy | 3.0/6: 50% combo_points temptation(3), master_of_subtlety, symbols_of_death, shadow_blades, finality_nightblade(6)
0:47.606 finish M eviscerate Fluffy_Pillow 52.0/100: 52% energy | 5.0/6: 83% combo_points temptation(3), master_of_subtlety, symbols_of_death, shadow_blades, finality_nightblade(6)
0:48.609 stealth_cds U shadow_dance Fluffy_Pillow 68.0/100: 68% energy | 0.0/6: 0% combo_points temptation(3), master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(5), finality_nightblade(6)
0:48.609 cds I use_item_ring_of_collapsing_futures Fluffy_Pillow 93.0/100: 93% energy | 0.0/6: 0% combo_points temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(5), finality_nightblade(6)
0:48.609 stealthed Y shadowstrike Fluffy_Pillow 93.0/100: 93% energy | 0.0/6: 0% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(5), finality_nightblade(6)
0:49.615 stealthed Y shadowstrike Fluffy_Pillow 70.0/100: 70% energy | 3.0/6: 50% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(5), finality_nightblade(6)
0:50.619 finish M eviscerate Fluffy_Pillow 47.0/100: 47% energy | 6.0/6: 100% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(5), finality_nightblade(6)
0:51.624 stealthed Y shadowstrike Fluffy_Pillow 63.0/100: 63% energy | 1.0/6: 17% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6)
0:52.629 stealthed Y shadowstrike Fluffy_Pillow 65.0/100: 65% energy | 4.0/6: 67% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6)
0:53.634 finish L nightblade Fluffy_Pillow 42.0/100: 42% energy | 6.0/6: 100% combo_points temptation(4), master_of_subtlety, symbols_of_death, shadow_blades, finality_nightblade(6)
0:54.640 stealth_cds U shadow_dance Fluffy_Pillow 68.1/100: 68% energy | 1.0/6: 17% combo_points temptation(4), master_of_subtlety, symbols_of_death, shadow_blades
0:54.640 stealthed Y shadowstrike Fluffy_Pillow 93.1/100: 93% energy | 1.0/6: 17% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades
0:55.645 stealthed Y shadowstrike Fluffy_Pillow 95.1/100: 95% energy | 4.0/6: 67% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades
0:56.651 finish M eviscerate Fluffy_Pillow 72.1/100: 72% energy | 6.0/6: 100% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death
0:57.656 stealthed Y shadowstrike Fluffy_Pillow 88.1/100: 88% energy | 1.0/6: 17% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6)
0:58.661 stealthed Y shadowstrike Fluffy_Pillow 90.1/100: 90% energy | 3.0/6: 50% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6)
0:59.666 finish M eviscerate Fluffy_Pillow 67.1/100: 67% energy | 5.0/6: 83% combo_points temptation(4), master_of_subtlety, symbols_of_death, finality_eviscerate(6)
1:00.670 stealth_cds V shadow_dance Fluffy_Pillow 83.1/100: 83% energy | 0.0/6: 0% combo_points temptation(4), master_of_subtlety, symbols_of_death
1:00.670 stealthed W symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death
1:00.670 stealthed Y shadowstrike Fluffy_Pillow 65.0/100: 65% energy | 0.0/6: 0% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death, death
1:01.672 stealthed Y shadowstrike Fluffy_Pillow 67.0/100: 67% energy | 2.0/6: 33% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death
1:02.678 finish M eviscerate Fluffy_Pillow 69.0/100: 69% energy | 5.0/6: 83% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death
1:03.684 stealthed Y shadowstrike Fluffy_Pillow 85.0/100: 85% energy | 0.0/6: 0% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5)
1:04.689 stealthed Y shadowstrike Fluffy_Pillow 62.0/100: 62% energy | 2.0/6: 33% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5)
1:05.694 finish M eviscerate Fluffy_Pillow 39.0/100: 39% energy | 5.0/6: 83% combo_points temptation(4), master_of_subtlety, symbols_of_death, finality_eviscerate(5)
1:06.700 cds K goremaws_bite Fluffy_Pillow 55.1/100: 55% energy | 0.0/6: 0% combo_points temptation(4), master_of_subtlety, symbols_of_death
1:07.707 build G backstab Fluffy_Pillow 71.1/100: 71% energy | 3.0/6: 50% combo_points temptation(4), master_of_subtlety, symbols_of_death, goremaws_bite
1:08.710 build G backstab Fluffy_Pillow 52.1/100: 52% energy | 4.0/6: 67% combo_points temptation(4), master_of_subtlety, symbols_of_death, goremaws_bite
1:09.715 Waiting     0.200 sec 33.1/100: 33% energy | 5.0/6: 83% combo_points temptation(4), master_of_subtlety, symbols_of_death, goremaws_bite
1:09.915 finish M eviscerate Fluffy_Pillow 35.3/100: 35% energy | 5.0/6: 83% combo_points temptation(4), master_of_subtlety, symbols_of_death, goremaws_bite
1:10.922 stealth_cds V shadow_dance Fluffy_Pillow 56.3/100: 56% energy | 1.0/6: 17% combo_points temptation(4), symbols_of_death, goremaws_bite, finality_eviscerate(5)
1:10.922 stealthed Y shadowstrike Fluffy_Pillow 81.3/100: 81% energy | 1.0/6: 17% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death, goremaws_bite, finality_eviscerate(5)
1:11.927 stealthed Y shadowstrike Fluffy_Pillow 63.3/100: 63% energy | 3.0/6: 50% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death, goremaws_bite, finality_eviscerate(5)
1:12.933 finish L nightblade Fluffy_Pillow 45.3/100: 45% energy | 5.0/6: 83% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5)
1:13.937 stealthed Y shadowstrike Fluffy_Pillow 71.3/100: 71% energy | 0.0/6: 0% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5), finality_nightblade(5)
1:14.942 stealthed Y shadowstrike Fluffy_Pillow 48.3/100: 48% energy | 2.0/6: 33% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5), finality_nightblade(5)
1:15.947 Waiting     1.000 sec 25.4/100: 25% energy | 4.0/6: 67% combo_points temptation(4), master_of_subtlety, symbols_of_death, finality_eviscerate(5), finality_nightblade(5)
1:16.947 finish M eviscerate Fluffy_Pillow 36.3/100: 36% energy | 6.0/6: 100% combo_points temptation(4), master_of_subtlety, symbols_of_death, finality_eviscerate(5), finality_nightblade(5)
1:17.951 stealth_cds V shadow_dance Fluffy_Pillow 52.3/100: 52% energy | 0.0/6: 0% combo_points temptation(4), master_of_subtlety, symbols_of_death, finality_nightblade(5)
1:17.951 stealthed Y shadowstrike Fluffy_Pillow 77.3/100: 77% energy | 0.0/6: 0% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(5)
1:18.955 stealthed Y shadowstrike Fluffy_Pillow 54.3/100: 54% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(5)
1:19.959 Waiting     0.800 sec 31.3/100: 31% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(5)
1:20.759 stealthed Y shadowstrike Fluffy_Pillow 40.1/100: 40% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(5)
1:21.764 Waiting     1.722 sec 17.1/100: 17% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(5)
1:23.486 finish M eviscerate Fluffy_Pillow 35.9/100: 36% energy | 6.0/6: 100% combo_points master_of_subtlety, symbols_of_death, finality_nightblade(5)
1:24.492 build G backstab Fluffy_Pillow 52.0/100: 52% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(6), finality_nightblade(5)
1:25.496 Waiting     2.200 sec 28.0/100: 28% energy | 2.0/6: 33% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(6), finality_nightblade(5)
1:27.696 build G backstab Fluffy_Pillow 52.1/100: 52% energy | 2.0/6: 33% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(6), finality_nightblade(5)
1:28.699 Waiting     1.400 sec 28.1/100: 28% energy | 3.0/6: 50% combo_points symbols_of_death, finality_eviscerate(6), finality_nightblade(5)
1:30.099 finish L nightblade Fluffy_Pillow 43.4/100: 43% energy | 5.0/6: 83% combo_points symbols_of_death, finality_eviscerate(6), finality_nightblade(5)
1:31.104 stealth_cds V shadow_dance Fluffy_Pillow 69.4/100: 69% energy | 0.0/6: 0% combo_points symbols_of_death, finality_eviscerate(6)
1:31.104 stealthed Y shadowstrike Fluffy_Pillow 94.4/100: 94% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6)
1:32.107 stealthed Y shadowstrike Fluffy_Pillow 71.4/100: 71% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6)
1:33.111 stealthed Y shadowstrike Fluffy_Pillow 48.4/100: 48% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6)
1:34.114 Waiting     0.900 sec 25.4/100: 25% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6)
1:35.014 finish M eviscerate Fluffy_Pillow 35.2/100: 35% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6)
1:36.017 stealthed W symbols_of_death Fluffy_Pillow 51.2/100: 51% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
1:36.017 Waiting     3.201 sec 16.2/100: 16% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, death
1:39.218 build G backstab Fluffy_Pillow 51.3/100: 51% energy | 1.0/6: 17% combo_points master_of_subtlety, symbols_of_death, death
1:40.223 Waiting     2.200 sec 27.3/100: 27% energy | 2.0/6: 33% combo_points master_of_subtlety, symbols_of_death, death
1:42.423 build G backstab Fluffy_Pillow 51.4/100: 51% energy | 4.0/6: 67% combo_points symbols_of_death, death
1:43.427 Waiting     0.700 sec 27.4/100: 27% energy | 5.0/6: 83% combo_points symbols_of_death, death
1:44.127 finish M eviscerate Fluffy_Pillow 35.1/100: 35% energy | 5.0/6: 83% combo_points symbols_of_death, death
1:45.133 stealth_cds V shadow_dance Fluffy_Pillow 51.1/100: 51% energy | 0.0/6: 0% combo_points symbols_of_death, death, finality_eviscerate(5)
1:45.133 stealthed Y shadowstrike Fluffy_Pillow 76.1/100: 76% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, death, finality_eviscerate(5)
1:46.140 stealthed Y shadowstrike Fluffy_Pillow 53.1/100: 53% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5)
1:47.146 Waiting     0.900 sec 30.1/100: 30% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5)
1:48.046 stealthed Y shadowstrike Fluffy_Pillow 40.0/100: 40% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5)
1:49.052 Waiting     0.828 sec 17.0/100: 17% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5)
1:49.880 finish L nightblade Fluffy_Pillow 26.1/100: 26% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5)
1:50.883 build G backstab Fluffy_Pillow 52.1/100: 52% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5), finality_nightblade(6)
1:51.886 Waiting     2.100 sec 28.1/100: 28% energy | 1.0/6: 17% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5), finality_nightblade(6)
1:53.986 build G backstab Fluffy_Pillow 51.1/100: 51% energy | 2.0/6: 33% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5), finality_nightblade(6)
1:54.992 Waiting     2.200 sec 27.1/100: 27% energy | 3.0/6: 50% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5), finality_nightblade(6)
1:57.192 build G backstab Fluffy_Pillow 51.2/100: 51% energy | 3.0/6: 50% combo_points symbols_of_death, finality_eviscerate(5), finality_nightblade(6)
1:58.195 Waiting     0.800 sec 27.2/100: 27% energy | 5.0/6: 83% combo_points symbols_of_death, finality_eviscerate(5), finality_nightblade(6)
1:58.995 finish M eviscerate Fluffy_Pillow 35.9/100: 36% energy | 5.0/6: 83% combo_points symbols_of_death, finality_eviscerate(5), finality_nightblade(6)
2:00.000 build G backstab Fluffy_Pillow 52.0/100: 52% energy | 0.0/6: 0% combo_points symbols_of_death, finality_nightblade(6)
2:01.005 Waiting     2.200 sec 28.0/100: 28% energy | 1.0/6: 17% combo_points symbols_of_death, finality_nightblade(6)
2:03.205 build G backstab Fluffy_Pillow 52.1/100: 52% energy | 3.0/6: 50% combo_points symbols_of_death, finality_nightblade(6)
2:04.210 Waiting     2.100 sec 28.1/100: 28% energy | 4.0/6: 67% combo_points symbols_of_death, finality_nightblade(6)
2:06.310 finish L nightblade Fluffy_Pillow 51.1/100: 51% energy | 6.0/6: 100% combo_points symbols_of_death, finality_nightblade(6)
2:07.313 stealth_cds V shadow_dance Fluffy_Pillow 77.1/100: 77% energy | 0.0/6: 0% combo_points symbols_of_death
2:07.313 stealthed W symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
2:07.313 stealthed Y shadowstrike Fluffy_Pillow 65.0/100: 65% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, death
2:08.317 stealthed Y shadowstrike Fluffy_Pillow 42.0/100: 42% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
2:09.320 stealthed Y shadowstrike Fluffy_Pillow 44.0/100: 44% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
2:10.324 Waiting     1.366 sec 21.0/100: 21% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
2:11.690 finish M eviscerate Fluffy_Pillow 35.9/100: 36% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
2:12.694 cds K goremaws_bite Fluffy_Pillow 51.9/100: 52% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(6)
2:13.698 build G backstab Fluffy_Pillow 67.9/100: 68% energy | 3.0/6: 50% combo_points master_of_subtlety, symbols_of_death, goremaws_bite, finality_eviscerate(6)
2:14.702 finish M eviscerate Fluffy_Pillow 48.9/100: 49% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death, goremaws_bite, finality_eviscerate(6)
2:15.706 stealth_cds V shadow_dance Fluffy_Pillow 69.9/100: 70% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, goremaws_bite
2:15.706 stealthed Y shadowstrike Fluffy_Pillow 94.9/100: 95% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, goremaws_bite
2:16.712 stealthed Y shadowstrike Fluffy_Pillow 77.0/100: 77% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, goremaws_bite
2:17.717 stealthed Y shadowstrike Fluffy_Pillow 59.0/100: 59% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, goremaws_bite
2:18.721 finish M eviscerate Fluffy_Pillow 41.0/100: 41% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
2:19.726 stealthed Y shadowstrike Fluffy_Pillow 57.0/100: 57% energy | 1.0/6: 17% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6)
2:20.731 Waiting     1.600 sec 34.0/100: 34% energy | 3.0/6: 50% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(6)
2:22.331 stealth_cds S vanish Fluffy_Pillow 51.5/100: 52% energy | 3.0/6: 50% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(6)
2:22.331 stealthed Y shadowstrike Fluffy_Pillow 76.5/100: 77% energy | 3.0/6: 50% combo_points master_of_subtlety_aura, vanish, symbols_of_death, finality_eviscerate(6)
2:23.335 finish M eviscerate Fluffy_Pillow 53.5/100: 54% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, vanish, subterfuge, symbols_of_death, finality_eviscerate(6)
2:24.341 stealthed Y shadowstrike Fluffy_Pillow 69.5/100: 70% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, vanish, subterfuge, symbols_of_death
2:25.345 build G backstab Fluffy_Pillow 71.5/100: 72% energy | 2.0/6: 33% combo_points master_of_subtlety, symbols_of_death
2:26.350 Waiting     0.400 sec 47.5/100: 48% energy | 3.0/6: 50% combo_points master_of_subtlety, symbols_of_death
2:26.750 build G backstab Fluffy_Pillow 51.9/100: 52% energy | 3.0/6: 50% combo_points master_of_subtlety, symbols_of_death
2:27.753 Waiting     0.400 sec 27.9/100: 28% energy | 4.0/6: 67% combo_points master_of_subtlety, symbols_of_death
2:28.153 finish L nightblade Fluffy_Pillow 32.3/100: 32% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death
2:29.158 stealth_cds V shadow_dance Fluffy_Pillow 58.3/100: 58% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, finality_nightblade(5)
2:29.158 stealthed Y shadowstrike Fluffy_Pillow 83.3/100: 83% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(5)
2:30.164 stealthed Y shadowstrike Fluffy_Pillow 60.3/100: 60% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(5)
2:31.169 Waiting     0.300 sec 37.3/100: 37% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(5)
2:31.469 stealthed Y shadowstrike Fluffy_Pillow 40.6/100: 41% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(5)
2:32.474 Waiting     1.672 sec 17.6/100: 18% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(5)
2:34.146 finish M eviscerate Fluffy_Pillow 36.0/100: 36% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(5)
2:35.150 stealth_cds T sprint Fluffy_Pillow 52.0/100: 52% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(6), finality_nightblade(5)
2:35.150 build G backstab Fluffy_Pillow 52.0/100: 52% energy | 0.0/6: 0% combo_points master_of_subtlety, sprint, symbols_of_death, finality_eviscerate(6), finality_nightblade(5), faster_than_light_trigger
2:36.155 Waiting     2.000 sec 28.0/100: 28% energy | 1.0/6: 17% combo_points master_of_subtlety, sprint, symbols_of_death, finality_eviscerate(6), finality_nightblade(5), faster_than_light_trigger
2:38.155 stealthed Y shadowstrike Fluffy_Pillow 74.9/100: 75% energy | 1.0/6: 17% combo_points master_of_subtlety_aura, vanish, subterfuge, sprint, symbols_of_death, finality_eviscerate(6), finality_nightblade(5)
2:39.159 stealthed Y shadowstrike Fluffy_Pillow 51.9/100: 52% energy | 3.0/6: 50% combo_points master_of_subtlety_aura, vanish, subterfuge, sprint, symbols_of_death, finality_eviscerate(6), finality_nightblade(5)
2:40.164 finish L nightblade Fluffy_Pillow 28.9/100: 29% energy | 5.0/6: 83% combo_points master_of_subtlety_aura, vanish, subterfuge, sprint, symbols_of_death, finality_eviscerate(6), finality_nightblade(5)
2:41.170 build G backstab Fluffy_Pillow 79.9/100: 80% energy | 0.0/6: 0% combo_points master_of_subtlety, sprint, symbols_of_death, finality_eviscerate(6)
2:42.175 build G backstab Fluffy_Pillow 55.9/100: 56% energy | 2.0/6: 33% combo_points master_of_subtlety, sprint, symbols_of_death, finality_eviscerate(6)
2:43.178 Waiting     1.800 sec 31.9/100: 32% energy | 3.0/6: 50% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(6)
2:44.978 build G backstab Fluffy_Pillow 51.6/100: 52% energy | 4.0/6: 67% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(6)
2:45.983 Waiting     0.700 sec 27.6/100: 28% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(6)
2:46.683 finish M eviscerate Fluffy_Pillow 35.3/100: 35% energy | 5.0/6: 83% combo_points symbols_of_death, finality_eviscerate(6)
2:47.687 stealth_cds V shadow_dance Fluffy_Pillow 51.3/100: 51% energy | 0.0/6: 0% combo_points symbols_of_death
2:47.687 stealthed W symbols_of_death Fluffy_Pillow 76.3/100: 76% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
2:47.687 stealthed Y shadowstrike Fluffy_Pillow 41.3/100: 41% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, death
2:48.691 stealthed Y shadowstrike Fluffy_Pillow 43.3/100: 43% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
2:49.695 Waiting     1.429 sec 20.3/100: 20% energy | 5.0/6: 83% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
2:51.124 finish M eviscerate Fluffy_Pillow 35.9/100: 36% energy | 5.0/6: 83% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
2:52.129 stealthed Y shadowstrike Fluffy_Pillow 52.0/100: 52% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5)
2:53.133 Waiting     2.100 sec 29.0/100: 29% energy | 2.0/6: 33% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5)
2:55.233 build G backstab Fluffy_Pillow 52.0/100: 52% energy | 3.0/6: 50% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5)
2:56.238 Waiting     2.200 sec 28.0/100: 28% energy | 4.0/6: 67% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5)
2:58.438 build G backstab Fluffy_Pillow 52.1/100: 52% energy | 4.0/6: 67% combo_points symbols_of_death, finality_eviscerate(5)
2:59.444 finish L nightblade Fluffy_Pillow 28.1/100: 28% energy | 5.0/6: 83% combo_points symbols_of_death, finality_eviscerate(5)
3:00.447 cds J shadow_blades Fluffy_Pillow 54.1/100: 54% energy | 0.0/6: 0% combo_points symbols_of_death, finality_eviscerate(5), finality_nightblade(5)
3:00.447 cds H potion Fluffy_Pillow 54.1/100: 54% energy | 0.0/6: 0% combo_points symbols_of_death, shadow_blades, finality_eviscerate(5), finality_nightblade(5)
3:00.447 build G backstab Fluffy_Pillow 54.1/100: 54% energy | 0.0/6: 0% combo_points symbols_of_death, shadow_blades, finality_eviscerate(5), finality_nightblade(5), potion_of_the_old_war
3:01.451 Waiting     2.000 sec 30.1/100: 30% energy | 2.0/6: 33% combo_points symbols_of_death, shadow_blades, finality_eviscerate(5), finality_nightblade(5), potion_of_the_old_war
3:03.451 build G backstab Fluffy_Pillow 52.0/100: 52% energy | 3.0/6: 50% combo_points symbols_of_death, shadow_blades, finality_eviscerate(5), finality_nightblade(5), fiery_enchant, potion_of_the_old_war
3:04.457 Waiting     0.700 sec 28.0/100: 28% energy | 5.0/6: 83% combo_points symbols_of_death, shadow_blades, finality_eviscerate(5), finality_nightblade(5), fiery_enchant, potion_of_the_old_war
3:05.157 finish M eviscerate Fluffy_Pillow 35.7/100: 36% energy | 5.0/6: 83% combo_points symbols_of_death, shadow_blades, finality_eviscerate(5), finality_nightblade(5), fiery_enchant, potion_of_the_old_war
3:06.160 stealth_cds V shadow_dance Fluffy_Pillow 51.7/100: 52% energy | 1.0/6: 17% combo_points symbols_of_death, shadow_blades, finality_nightblade(5), fiery_enchant, potion_of_the_old_war
3:06.160 stealthed Y shadowstrike Fluffy_Pillow 76.7/100: 77% energy | 1.0/6: 17% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(5), fiery_enchant, potion_of_the_old_war
3:07.165 stealthed Y shadowstrike Fluffy_Pillow 53.7/100: 54% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(5), fiery_enchant, potion_of_the_old_war
3:08.168 Waiting     0.400 sec 30.7/100: 31% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(5), fiery_enchant, potion_of_the_old_war
3:08.568 finish M eviscerate Fluffy_Pillow 35.0/100: 35% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(5), fiery_enchant, potion_of_the_old_war
3:09.572 stealthed Y shadowstrike Fluffy_Pillow 51.0/100: 51% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(5), fiery_enchant, potion_of_the_old_war
3:10.576 stealthed Y shadowstrike Fluffy_Pillow 53.0/100: 53% energy | 3.0/6: 50% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(5), fiery_enchant, potion_of_the_old_war
3:11.582 finish L nightblade Fluffy_Pillow 30.1/100: 30% energy | 6.0/6: 100% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(5), fiery_enchant, potion_of_the_old_war
3:12.587 cds K goremaws_bite Fluffy_Pillow 56.1/100: 56% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), fiery_enchant, potion_of_the_old_war
3:13.698 build G backstab Fluffy_Pillow 73.2/100: 73% energy | 3.0/6: 50% combo_points master_of_subtlety, symbols_of_death, shadow_blades, goremaws_bite, finality_eviscerate(6), fiery_enchant, potion_of_the_old_war
3:14.703 finish M eviscerate Fluffy_Pillow 54.3/100: 54% energy | 6.0/6: 100% combo_points master_of_subtlety, symbols_of_death, shadow_blades, goremaws_bite, finality_eviscerate(6), fiery_enchant, potion_of_the_old_war
3:15.708 stealth_cds V shadow_dance Fluffy_Pillow 75.3/100: 75% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, shadow_blades, goremaws_bite, fiery_enchant, potion_of_the_old_war
3:15.708 stealthed W symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, goremaws_bite, fiery_enchant, potion_of_the_old_war
3:15.708 stealthed Y shadowstrike Fluffy_Pillow 65.0/100: 65% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, goremaws_bite, death, fiery_enchant, potion_of_the_old_war
3:16.713 stealthed Y shadowstrike Fluffy_Pillow 47.0/100: 47% energy | 3.0/6: 50% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, goremaws_bite, fiery_enchant, potion_of_the_old_war
3:17.719 Waiting     0.600 sec 29.0/100: 29% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, goremaws_bite, fiery_enchant, potion_of_the_old_war
3:18.319 finish M eviscerate Fluffy_Pillow 35.6/100: 36% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, goremaws_bite, fiery_enchant, potion_of_the_old_war
3:19.322 stealthed Y shadowstrike Fluffy_Pillow 56.6/100: 57% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), fiery_enchant, potion_of_the_old_war
3:20.325 Waiting     1.600 sec 33.6/100: 34% energy | 3.0/6: 50% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), fiery_enchant, potion_of_the_old_war
3:21.925 build G backstab Fluffy_Pillow 51.1/100: 51% energy | 4.0/6: 67% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), fiery_enchant, potion_of_the_old_war
3:22.928 Waiting     0.800 sec 27.1/100: 27% energy | 6.0/6: 100% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), potion_of_the_old_war
3:23.728 finish M eviscerate Fluffy_Pillow 35.9/100: 36% energy | 6.0/6: 100% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), potion_of_the_old_war
3:24.731 stealth_cds V shadow_dance Fluffy_Pillow 51.8/100: 52% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, shadow_blades, potion_of_the_old_war
3:24.731 stealthed Y shadowstrike Fluffy_Pillow 76.8/100: 77% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, potion_of_the_old_war
3:25.736 stealthed Y shadowstrike Fluffy_Pillow 53.9/100: 54% energy | 3.0/6: 50% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades
3:26.741 Waiting     0.400 sec 30.9/100: 31% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades
3:27.141 finish M eviscerate Fluffy_Pillow 35.2/100: 35% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades
3:28.147 stealthed Y shadowstrike Fluffy_Pillow 51.3/100: 51% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6)
3:29.151 Waiting     2.100 sec 28.3/100: 28% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6)
3:31.251 build G backstab Fluffy_Pillow 51.3/100: 51% energy | 4.0/6: 67% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6)
3:32.254 finish L nightblade Fluffy_Pillow 27.3/100: 27% energy | 6.0/6: 100% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6)
3:33.260 build G backstab Fluffy_Pillow 53.3/100: 53% energy | 1.0/6: 17% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6)
3:34.264 Waiting     1.400 sec 29.3/100: 29% energy | 3.0/6: 50% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6)
3:35.664 finish M eviscerate Fluffy_Pillow 44.6/100: 45% energy | 5.0/6: 83% combo_points symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6)
3:36.668 stealth_cds V shadow_dance Fluffy_Pillow 60.6/100: 61% energy | 0.0/6: 0% combo_points symbols_of_death, shadow_blades, finality_nightblade(6)
3:36.668 stealthed Y shadowstrike Fluffy_Pillow 85.6/100: 86% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6)
3:37.671 stealthed Y shadowstrike Fluffy_Pillow 87.6/100: 88% energy | 3.0/6: 50% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6)
3:38.674 finish M eviscerate Fluffy_Pillow 64.6/100: 65% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6)
3:39.679 stealthed W symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6)
3:39.679 stealthed Y shadowstrike Fluffy_Pillow 65.0/100: 65% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, death, finality_eviscerate(6), finality_nightblade(6)
3:40.685 finish M eviscerate Fluffy_Pillow 42.0/100: 42% energy | 5.0/6: 83% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6)
3:41.689 build G backstab Fluffy_Pillow 58.0/100: 58% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_nightblade(6)
3:42.694 Waiting     1.600 sec 34.0/100: 34% energy | 2.0/6: 33% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_nightblade(6)
3:44.294 build G backstab Fluffy_Pillow 51.6/100: 52% energy | 3.0/6: 50% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_nightblade(6)
3:45.297 Waiting     0.700 sec 27.5/100: 28% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death, finality_nightblade(6)
3:45.997 finish M eviscerate Fluffy_Pillow 35.2/100: 35% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death, finality_nightblade(6)
3:47.002 stealth_cds V shadow_dance Fluffy_Pillow 51.2/100: 51% energy | 0.0/6: 0% combo_points symbols_of_death, finality_eviscerate(5), finality_nightblade(6)
3:47.002 stealthed Y shadowstrike Fluffy_Pillow 76.2/100: 76% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5), finality_nightblade(6)
3:48.006 stealthed Y shadowstrike Fluffy_Pillow 53.2/100: 53% energy | 3.0/6: 50% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5), finality_nightblade(6)
3:49.010 finish L nightblade Fluffy_Pillow 55.2/100: 55% energy | 5.0/6: 83% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5), finality_nightblade(6)
3:50.016 stealthed Y shadowstrike Fluffy_Pillow 81.2/100: 81% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5)
3:51.020 stealthed Y shadowstrike Fluffy_Pillow 58.2/100: 58% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5)
3:52.025 Waiting     0.100 sec 35.2/100: 35% energy | 4.0/6: 67% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5)
3:52.125 finish M eviscerate Fluffy_Pillow 36.3/100: 36% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5)
3:53.129 build G backstab Fluffy_Pillow 52.3/100: 52% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death
3:54.134 Waiting     2.100 sec 28.4/100: 28% energy | 1.0/6: 17% combo_points master_of_subtlety, symbols_of_death
3:56.234 build G backstab Fluffy_Pillow 51.4/100: 51% energy | 1.0/6: 17% combo_points master_of_subtlety, symbols_of_death
3:57.238 Waiting     2.200 sec 27.4/100: 27% energy | 4.0/6: 67% combo_points symbols_of_death
3:59.438 build G backstab Fluffy_Pillow 51.5/100: 51% energy | 4.0/6: 67% combo_points symbols_of_death
4:00.441 Waiting     0.700 sec 27.4/100: 27% energy | 5.0/6: 83% combo_points symbols_of_death
4:01.141 finish M eviscerate Fluffy_Pillow 35.1/100: 35% energy | 5.0/6: 83% combo_points symbols_of_death
4:02.143 stealth_cds V shadow_dance Fluffy_Pillow 51.1/100: 51% energy | 0.0/6: 0% combo_points symbols_of_death, finality_eviscerate(5)
4:02.143 stealthed Y shadowstrike Fluffy_Pillow 76.1/100: 76% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5)
4:03.149 stealthed Y shadowstrike Fluffy_Pillow 78.1/100: 78% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5)
4:04.154 finish M eviscerate Fluffy_Pillow 55.1/100: 55% energy | 5.0/6: 83% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5)
4:05.158 stealthed Y shadowstrike Fluffy_Pillow 71.1/100: 71% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
4:06.162 stealthed Y shadowstrike Fluffy_Pillow 48.1/100: 48% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
4:07.166 finish L nightblade Fluffy_Pillow 50.1/100: 50% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death
4:08.172 build G backstab Fluffy_Pillow 76.1/100: 76% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, finality_nightblade(5)
4:09.177 build G backstab Fluffy_Pillow 52.1/100: 52% energy | 1.0/6: 17% combo_points master_of_subtlety, symbols_of_death, finality_nightblade(5)
4:10.179 Waiting     2.100 sec 28.1/100: 28% energy | 3.0/6: 50% combo_points master_of_subtlety, symbols_of_death, finality_nightblade(5)
4:12.279 build G backstab Fluffy_Pillow 51.1/100: 51% energy | 3.0/6: 50% combo_points symbols_of_death, finality_nightblade(5)
4:13.285 Waiting     1.900 sec 27.2/100: 27% energy | 4.0/6: 67% combo_points symbols_of_death, finality_nightblade(5)
4:15.185 finish M eviscerate Fluffy_Pillow 48.0/100: 48% energy | 6.0/6: 100% combo_points symbols_of_death, finality_nightblade(5)
4:16.191 cds K goremaws_bite Fluffy_Pillow 64.0/100: 64% energy | 0.0/6: 0% combo_points symbols_of_death, finality_eviscerate(6), finality_nightblade(5)
4:17.194 build G backstab Fluffy_Pillow 80.0/100: 80% energy | 3.0/6: 50% combo_points symbols_of_death, goremaws_bite, finality_eviscerate(6), finality_nightblade(5)
4:18.199 build G backstab Fluffy_Pillow 61.0/100: 61% energy | 4.0/6: 67% combo_points symbols_of_death, goremaws_bite, finality_eviscerate(6), finality_nightblade(5)
4:19.202 finish M eviscerate Fluffy_Pillow 42.0/100: 42% energy | 5.0/6: 83% combo_points symbols_of_death, goremaws_bite, finality_eviscerate(6), finality_nightblade(5)
4:20.205 stealth_cds V shadow_dance Fluffy_Pillow 63.0/100: 63% energy | 1.0/6: 17% combo_points symbols_of_death, goremaws_bite, finality_nightblade(5)
4:20.205 stealthed W symbols_of_death Fluffy_Pillow 88.0/100: 88% energy | 1.0/6: 17% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, goremaws_bite, finality_nightblade(5)
4:20.205 stealthed Y shadowstrike Fluffy_Pillow 53.0/100: 53% energy | 1.0/6: 17% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, goremaws_bite, death, finality_nightblade(5)
4:21.209 Waiting     0.500 sec 35.0/100: 35% energy | 3.0/6: 50% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, goremaws_bite, finality_nightblade(5)
4:21.709 stealthed Y shadowstrike Fluffy_Pillow 40.4/100: 40% energy | 3.0/6: 50% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, goremaws_bite, finality_nightblade(5)
4:22.712 Waiting     0.335 sec 22.4/100: 22% energy | 5.0/6: 83% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(5)
4:23.047 finish L nightblade Fluffy_Pillow 26.1/100: 26% energy | 5.0/6: 83% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(5)
4:24.051 stealthed Y shadowstrike Fluffy_Pillow 52.1/100: 52% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
4:25.055 Waiting     2.000 sec 29.1/100: 29% energy | 3.0/6: 50% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
4:27.055 stealth_cds S vanish Fluffy_Pillow 51.0/100: 51% energy | 3.0/6: 50% combo_points master_of_subtlety, symbols_of_death
4:27.055 stealthed Y shadowstrike Fluffy_Pillow 76.0/100: 76% energy | 3.0/6: 50% combo_points master_of_subtlety_aura, vanish, symbols_of_death
4:28.060 finish M eviscerate Fluffy_Pillow 53.0/100: 53% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, vanish, subterfuge, symbols_of_death
4:29.066 stealthed Y shadowstrike Fluffy_Pillow 69.0/100: 69% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, vanish, subterfuge, symbols_of_death, finality_eviscerate(6)
4:30.071 build G backstab Fluffy_Pillow 71.0/100: 71% energy | 2.0/6: 33% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(6)
4:31.075 Waiting     0.400 sec 47.0/100: 47% energy | 4.0/6: 67% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(6)
4:31.475 build G backstab Fluffy_Pillow 51.4/100: 51% energy | 4.0/6: 67% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(6)
4:32.480 Waiting     0.700 sec 27.4/100: 27% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(6)
4:33.180 finish M eviscerate Fluffy_Pillow 35.1/100: 35% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(6)
4:34.184 stealth_cds V shadow_dance Fluffy_Pillow 51.1/100: 51% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death
4:34.184 stealthed Y shadowstrike Fluffy_Pillow 76.1/100: 76% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
4:35.188 stealthed Y shadowstrike Fluffy_Pillow 53.1/100: 53% energy | 3.0/6: 50% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
4:36.191 finish M eviscerate Fluffy_Pillow 55.1/100: 55% energy | 5.0/6: 83% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
4:37.195 stealthed Y shadowstrike Fluffy_Pillow 71.1/100: 71% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5)
4:38.200 stealthed Y shadowstrike Fluffy_Pillow 48.1/100: 48% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5)
4:39.205 finish L nightblade Fluffy_Pillow 50.1/100: 50% energy | 6.0/6: 100% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5)
4:40.209 stealth_cds T sprint Fluffy_Pillow 76.1/100: 76% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5), finality_nightblade(6)
4:40.209 stealth_cds V shadow_dance Fluffy_Pillow 76.1/100: 76% energy | 0.0/6: 0% combo_points master_of_subtlety, sprint, symbols_of_death, finality_eviscerate(5), finality_nightblade(6), faster_than_light_trigger
4:40.209 stealthed W symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, sprint, symbols_of_death, finality_eviscerate(5), finality_nightblade(6), faster_than_light_trigger
4:40.209 stealthed Y shadowstrike Fluffy_Pillow 65.0/100: 65% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, sprint, symbols_of_death, death, finality_eviscerate(5), finality_nightblade(6), faster_than_light_trigger
4:41.213 stealthed Y shadowstrike Fluffy_Pillow 42.0/100: 42% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, sprint, symbols_of_death, finality_eviscerate(5), finality_nightblade(6), faster_than_light_trigger
4:42.217 stealthed Y shadowstrike Fluffy_Pillow 44.0/100: 44% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, shadow_dance, sprint, symbols_of_death, finality_eviscerate(5), finality_nightblade(6), faster_than_light_trigger
4:43.222 finish M eviscerate Fluffy_Pillow 71.0/100: 71% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, vanish, subterfuge, sprint, symbols_of_death, finality_eviscerate(5), finality_nightblade(6)
4:44.226 stealthed Y shadowstrike Fluffy_Pillow 87.0/100: 87% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, vanish, subterfuge, sprint, symbols_of_death, finality_nightblade(6)
4:45.229 stealthed Y shadowstrike Fluffy_Pillow 64.0/100: 64% energy | 2.0/6: 33% combo_points master_of_subtlety, vanish, subterfuge, sprint, symbols_of_death, finality_nightblade(6)
4:46.234 build G backstab Fluffy_Pillow 91.0/100: 91% energy | 4.0/6: 67% combo_points master_of_subtlety, sprint, symbols_of_death, finality_nightblade(6)
4:47.240 finish M eviscerate Fluffy_Pillow 67.0/100: 67% energy | 5.0/6: 83% combo_points master_of_subtlety, sprint, symbols_of_death, finality_nightblade(6)
4:48.244 build G backstab Fluffy_Pillow 83.0/100: 83% energy | 2.0/6: 33% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5), finality_nightblade(6)
4:49.247 build G backstab Fluffy_Pillow 59.0/100: 59% energy | 3.0/6: 50% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5), finality_nightblade(6)
4:50.252 Waiting     1.500 sec 35.0/100: 35% energy | 4.0/6: 67% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5), finality_nightblade(6)
4:51.752 build G backstab Fluffy_Pillow 51.5/100: 51% energy | 4.0/6: 67% combo_points symbols_of_death, finality_eviscerate(5), finality_nightblade(6)
4:52.758 Waiting     0.700 sec 27.5/100: 27% energy | 5.0/6: 83% combo_points symbols_of_death, finality_eviscerate(5), finality_nightblade(6)
4:53.458 finish M eviscerate Fluffy_Pillow 35.1/100: 35% energy | 5.0/6: 83% combo_points symbols_of_death, finality_eviscerate(5), finality_nightblade(6)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 8806 8481 0
Agility 32993 31287 20768 (13012)
Stamina 48391 48391 28183
Intellect 5325 5000 0
Spirit 0 0 0
Health 2903460 2903460 0
Energy 100 100 0
Combo Points 6 6 0
Crit 23.64% 23.64% 5456
Haste 9.55% 9.55% 3581
Damage / Heal Versatility 9.03% 8.23% 3909
Attack Power 32993 31287 0
Mastery 80.81% 80.81% 8510
Armor 2297 2297 2297
Run Speed 8 0 0

Gear

Source Slot Average Item Level: 891.00
Local Head Cowl of Fright
ilevel: 885, stats: { 300 Armor, +2829 Sta, +1886 AgiInt, +1015 Mastery, +547 Crit, +1076 unknown }
Local Neck Sea Fan Pendant
ilevel: 880, stats: { +1519 Sta, +1633 Vers, +965 Mastery }, enchant: mark_of_the_hidden_satyr
Local Shoulders Steelgazer Hide Mantle
ilevel: 880, stats: { 273 Armor, +1351 AgiInt, +2027 Sta, +673 Haste, +476 Vers, +771 unknown }
Local Shirt Common Gray Shirt
ilevel: 1
Local Chest Biornskin Vest
ilevel: 890, stats: { 376 Armor, +1977 AgiInt, +2965 Sta, +1034 Crit, +557 Mastery }
Local Waist Strand of Whelk Shells
ilevel: 880, stats: { 205 Armor, +2026 Sta, +1351 AgiInt, +673 Haste, +476 Mastery }, gems: { +150 Mastery }
Local Legs Legwraps of Unworthy Souls
ilevel: 880, stats: { 318 Armor, +2701 Sta, +1801 AgiInt, +964 Mastery, +570 Haste }
Local Feet Shadow Satyr's Walk
ilevel: 910, stats: { 276 Armor, +2680 Sta, +1786 Agi, +827 Haste, +459 Mastery }
Local Wrists Denial of the Half-Giants
ilevel: 910, stats: { 176 Armor, +2010 Sta, +1340 Agi, +276 Crit, +689 Mastery }
Local Hands Cruel Vice Grips
ilevel: 885, stats: { 231 Armor, +2122 Sta, +1415 AgiInt, +686 Crit, +485 Mastery }
Local Finger1 Grubby Silver Ring
ilevel: 880, stats: { +1519 Sta, +1484 Crit, +1114 Vers }, gems: { +150 Vers }, enchant: { +200 Mastery }
Local Finger2 Ring of Collapsing Futures
ilevel: 870, stats: { +1385 Sta, +1677 Mastery, +768 Haste, +419 Avoidance }, enchant: { +200 Vers }
Local Trinket1 Arcanogolem Digit
ilevel: 910, stats: { +2264 Agi }
Local Trinket2 Entwined Elemental Foci
ilevel: 910, stats: { +2264 StrAgi }
Local Back Drape of the Mana-Starved
ilevel: 875, stats: { 142 Armor, +1450 Sta, +967 StrAgiInt, +586 Crit, +259 Vers }, gems: { +200 Agi }, enchant: { +200 Agi }
Local Main Hand Fangs of the Devourer
ilevel: 906, weapon: { 3844 - 7140, 1.8 }, stats: { +983 Agi, +1475 Sta, +368 Crit, +353 Mastery }, relics: { +53 ilevels, +51 ilevels, +52 ilevels }
Local Off Hand Fangs of the Devourer
ilevel: 906, weapon: { 3844 - 7140, 1.8 }, stats: { +983 Agi, +1475 Sta, +368 Crit, +353 Mastery }

Talents

Level
15 Master of Subtlety (Subtlety Rogue) Weaponmaster (Subtlety Rogue) Gloomblade (Subtlety Rogue)
30 Nightstalker Subterfuge Shadow Focus
45 Deeper Stratagem Anticipation Vigor
60 Soothing Darkness (Subtlety Rogue) Elusiveness Cheat Death
75 Strike from the Shadows (Subtlety Rogue) Prey on the Weak Tangled Shadow (Subtlety Rogue)
90 Premeditation (Subtlety Rogue) Alacrity Enveloping Shadows (Subtlety Rogue)
100 Master of Shadows (Subtlety Rogue) Marked for Death Death from Above

Profile

rogue="AD+EEF"
origin="https://eu.api.battle.net/wow/character/dalaran/Esdeåth/advanced"
level=110
race=human
role=attack
position=back
professions=alchemy=800/enchanting=133
talents=1210011
artifact=17:0:0:0:0:851:1:852:3:853:3:854:3:855:3:856:3:857:3:858:3:859:3:860:3:861:1:862:1:863:1:864:1:865:1:866:1:1349:1:1386:14
spec=subtlety

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,name=flask_of_the_seventh_demon
actions.precombat+=/augmentation,name=defiled
actions.precombat+=/food,name=seedbattered_fish_plate
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/stealth
actions.precombat+=/potion,name=old_war
actions.precombat+=/marked_for_death,if=raid_event.adds.in>40
# Defined variables that doesn't change during the fight
actions.precombat+=/variable,name=ssw_refund,value=equipped.shadow_satyrs_walk*(4+ssw_refund_offset)
actions.precombat+=/variable,name=stealth_threshold,value=(15+talent.vigor.enabled*35+talent.master_of_shadows.enabled*30+variable.ssw_refund)
actions.precombat+=/enveloping_shadows,if=combo_points>=5
actions.precombat+=/symbols_of_death

# Executed every time the actor is available.
actions=call_action_list,name=cds
# Fully switch to the Stealthed Rotation (by doing so, it forces pooling if nothing is available)
actions+=/run_action_list,name=stealthed,if=stealthed.all
actions+=/call_action_list,name=finish,if=combo_points>=5|(combo_points>=4&spell_targets.shuriken_storm>=3&spell_targets.shuriken_storm<=4)
actions+=/call_action_list,name=stealth_als,if=combo_points.deficit>=2+talent.premeditation.enabled
actions+=/call_action_list,name=build,if=energy.deficit<=variable.stealth_threshold

# Builders
actions.build=shuriken_storm,if=spell_targets.shuriken_storm>=2
actions.build+=/gloomblade
actions.build+=/backstab

# Cooldowns
actions.cds=potion,name=old_war,if=buff.bloodlust.react|target.time_to_die<=25|buff.shadow_blades.up
actions.cds+=/use_item,slot=finger2,if=(buff.shadow_blades.up&stealthed.rogue)|target.time_to_die<20
actions.cds+=/blood_fury,if=stealthed.rogue
actions.cds+=/berserking,if=stealthed.rogue
actions.cds+=/arcane_torrent,if=stealthed.rogue&energy.deficit>70
actions.cds+=/shadow_blades,if=combo_points<=2|(equipped.denial_of_the_halfgiants&combo_points>=1)
actions.cds+=/goremaws_bite,if=!stealthed.all&cooldown.shadow_dance.charges_fractional<=2.45&((combo_points.deficit>=4-(time<10)*2&energy.deficit>50+talent.vigor.enabled*25-(time>=10)*15)|target.time_to_die<8)
actions.cds+=/marked_for_death,target_if=min:target.time_to_die,if=target.time_to_die<combo_points.deficit|(raid_event.adds.in>40&combo_points.deficit>=4+talent.deeper_strategem.enabled+talent.anticipation.enabled)

# Finishers
actions.finish=enveloping_shadows,if=buff.enveloping_shadows.remains<target.time_to_die&buff.enveloping_shadows.remains<=combo_points*1.8
actions.finish+=/death_from_above,if=spell_targets.death_from_above>=6
actions.finish+=/nightblade,cycle_targets=1,if=target.time_to_die>8&((refreshable&(!finality|buff.finality_nightblade.up))|remains<tick_time)
actions.finish+=/death_from_above
actions.finish+=/eviscerate

# Stealth Action List Starter
actions.stealth_als=call_action_list,name=stealth_cds,if=energy.deficit<=variable.stealth_threshold&(!equipped.shadow_satyrs_walk|cooldown.shadow_dance.charges_fractional>=2.45|energy.deficit>=10)
actions.stealth_als+=/call_action_list,name=stealth_cds,if=spell_targets.shuriken_storm>=5
actions.stealth_als+=/call_action_list,name=stealth_cds,if=(cooldown.shadowmeld.up&!cooldown.vanish.up&cooldown.shadow_dance.charges<=1)
actions.stealth_als+=/call_action_list,name=stealth_cds,if=target.time_to_die<12*cooldown.shadow_dance.charges_fractional*(1+equipped.shadow_satyrs_walk*0.5)

# Stealth Cooldowns
actions.stealth_cds=shadow_dance,if=charges_fractional>=2.45
actions.stealth_cds+=/vanish
actions.stealth_cds+=/sprint_offensive
actions.stealth_cds+=/shadow_dance,if=charges>=2&combo_points<=1
actions.stealth_cds+=/pool_resource,for_next=1,extra_amount=40
actions.stealth_cds+=/shadowmeld,if=energy>=40&energy.deficit>=10+variable.ssw_refund
actions.stealth_cds+=/shadow_dance,if=combo_points<=1

# Stealthed Rotation
actions.stealthed=symbols_of_death,if=(buff.symbols_of_death.remains<target.time_to_die-4&buff.symbols_of_death.remains<=buff.symbols_of_death.duration*0.3)|equipped.shadow_satyrs_walk&energy.time_to_max<0.25
actions.stealthed+=/call_action_list,name=finish,if=combo_points>=5
actions.stealthed+=/shuriken_storm,if=buff.shadowmeld.down&((combo_points.deficit>=3&spell_targets.shuriken_storm>=2+talent.premeditation.enabled+equipped.shadow_satyrs_walk)|buff.the_dreadlords_deceit.stack>=29)
actions.stealthed+=/shadowstrike

head=cowl_of_fright,id=139205,bonus_id=1805/43/1507/3337
neck=sea_fan_pendant,id=142428,bonus_id=3507/1497,enchant=mark_of_the_hidden_satyr
shoulders=steelgazer_hide_mantle,id=134154,bonus_id=3417/43/1542/3337
back=drape_of_the_manastarved,id=141543,bonus_id=1808/1487/3337,gems=200agi,enchant=200agi
chest=biornskin_vest,id=134197,bonus_id=3417/1552/3337
shirt=common_gray_shirt,id=3428
wrists=denial_of_the_halfgiants,id=137100,bonus_id=3459/3458
hands=cruel_vice_grips,id=133617,bonus_id=3510/1537/3337
waist=strand_of_whelk_shells,id=142416,bonus_id=3507/1808/1497,gems=150mastery
legs=legwraps_of_unworthy_souls,id=133616,bonus_id=3418/1532/3337
feet=shadow_satyrs_walk,id=137032,bonus_id=3459/3458
finger1=grubby_silver_ring,id=139236,bonus_id=1806/1808/1502,gems=150vers,enchant=200mastery
finger2=ring_of_collapsing_futures,id=142173,bonus_id=40/3453/1482/3336,enchant=200vers
trinket1=arcanogolem_digit,id=140794,bonus_id=3519
trinket2=entwined_elemental_foci,id=140796,bonus_id=3519
main_hand=fangs_of_the_devourer,id=128476,bonus_id=743,gem_id=139267/142512/139253/0,relic_id=1806:1507:3336/3468:1492/1806:1502/0
off_hand=fangs_of_the_devourer,id=128479

# Gear Summary
# gear_ilvl=891.06
# gear_agility=20768
# gear_stamina=28183
# gear_crit_rating=5349
# gear_haste_rating=3511
# gear_mastery_rating=8343
# gear_versatility_rating=3832
# gear_avoidance_rating=419
# gear_armor=2297

AD+NF : 598884 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
598884.0 598884.0 798.5 / 0.133% 110858.2 / 18.5% 20687.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
28.8 28.8 Energy 23.06% 56.5 100.0% 100%
Origin https://eu.api.battle.net/wow/character/dalaran/Esdeåth/advanced
Talents
  • 15: Master of Subtlety (Subtlety Rogue)
  • 30: Subterfuge
  • 45: Deeper Stratagem
  • 90: Premeditation (Subtlety Rogue)
  • 100: Master of Shadows (Subtlety Rogue)
  • Talent Calculator
Artifact
Professions
  • alchemy: 800
  • enchanting: 133

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
AD+NF 598884
Arcane Swipe 10439 1.7% 32.8 9.20sec 95639 0 Direct 32.8 77263 154523 95644 23.8% 0.0%  

Stats details: arcane_swipe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 32.85 32.85 0.00 0.00 0.0000 0.0000 3141536.74 3141536.74 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 25.03 76.21% 77262.56 59397 78404 77279.25 74748 78404 1934231 1934231 0.00
crit 7.81 23.79% 154522.95 118793 156807 154528.51 0 156807 1207306 1207306 0.00
 
 

Action details: arcane_swipe

Static Values
  • id:225721
  • school:arcane
  • resource:none
  • range:12.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:225721
  • name:Arcane Swipe
  • school:arcane
  • tooltip:
  • description:{$@spelldesc225127=Your melee attacks have a chance to rake all enemies in front of you for {$225721s1=18328} Arcane damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:48856.63
  • base_dd_max:48856.63
 
auto_attack_mh 10265 1.7% 119.6 2.04sec 26105 16415 Direct 119.6 24981 49960 26106 23.6% 19.1%  

Stats details: auto_attack_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 119.57 119.57 0.00 0.00 1.5903 0.0000 3121428.19 4588795.11 31.98 16415.35 16415.35
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 68.55 57.33% 24981.09 19317 25498 24988.19 24379 25384 1712411 2517406 31.98
crit 28.20 23.59% 49959.56 38633 50996 49974.53 47667 50996 1409017 2071389 31.98
miss 22.82 19.09% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_mh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
auto_attack_oh 5099 0.9% 118.7 2.06sec 13066 8153 Direct 118.7 12490 24977 13065 23.6% 19.0%  

Stats details: auto_attack_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 118.66 118.66 0.00 0.00 1.6027 0.0000 1550462.59 2279326.88 31.98 8152.78 8152.78
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 68.13 57.42% 12489.67 9658 12749 12493.27 12067 12708 850951 1250979 31.98
crit 28.01 23.60% 24977.12 19317 25498 24984.78 23759 25498 699511 1028348 31.98
miss 22.53 18.98% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_oh

Static Values
  • id:1
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Backstab 28793 4.8% 51.2 5.61sec 169962 169201 Direct 51.2 137338 274716 169963 23.7% 0.0%  

Stats details: backstab

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 51.22 51.22 0.00 0.00 1.0045 0.0000 8706257.96 12799023.88 31.98 169201.40 169201.40
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.06 76.25% 137337.85 106732 140886 137376.98 133083 140473 5364401 7886177 31.98
crit 12.16 23.75% 274716.42 213463 281772 274764.15 249325 281772 3341857 4912847 31.98
 
 

Action details: backstab

Static Values
  • id:53
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:53
  • name:Backstab
  • school:physical
  • tooltip:
  • description:Stab the target, causing ${$sw2*$<mult>} Physical damage. Damage increased by {$s4=30}% when you are behind your target. |cFFFFFFFFAwards {$s3=1} combo $lpoint:points;.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.70
 
Collapse 1603 0.3% 5.8 42.52sec 82043 0 Direct 5.8 66468 132946 82040 23.4% 0.0%  

Stats details: collapse

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.81 5.81 0.00 0.00 0.0000 0.0000 476534.87 476534.87 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.45 76.57% 66467.73 50574 66758 66088.89 0 66758 295613 295613 0.00
crit 1.36 23.43% 132945.54 101148 133516 98129.25 0 133516 180921 180921 0.00
 
 

Action details: collapse

Static Values
  • id:234142
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:15.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:234142
  • name:Collapse
  • school:shadow
  • tooltip:
  • description:Deal {$s1=40000} Shadow damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:40000.00
  • base_dd_max:40000.00
 
Eviscerate 171426 28.6% 53.2 5.61sec 965588 961273 Direct 53.2 696406 1393061 965601 38.6% 0.0%  

Stats details: eviscerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 53.19 53.19 0.00 0.00 1.0045 0.0000 51356016.90 75498209.41 31.98 961273.13 961273.13
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 32.64 61.36% 696405.72 432169 848849 696771.90 649705 751198 22727619 33411753 31.98
crit 20.55 38.64% 1393061.26 864338 1697697 1393805.65 1261698 1539137 28628398 42086456 31.98
 
 

Action details: eviscerate

Static Values
  • id:196819
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.15
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:196819
  • name:Eviscerate
  • school:physical
  • tooltip:
  • description:Finishing move that disembowels the target, causing damage per combo point. 1 point : ${$m1*1} damage 2 points: ${$m1*2} damage 3 points: ${$m1*3} damage 4 points: ${$m1*4} damage 5 points: ${$m1*5} damage{$?s193531=false}[ 6 points: ${$m1*6} damage][]
Weapon
  • normalized:false
  • weapon_power_mod:0.000000
  • weapon_multiplier:0.00
 
Goremaw's Bite 0 (10010) 0.0% (1.7%) 4.7 63.50sec 647215 644385

Stats details: goremaws_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.66 0.00 0.00 0.00 1.0045 0.0000 0.00 0.00 0.00 644384.70 644384.70
 
 

Action details: goremaws_bite

Static Values
  • id:209782
  • school:shadow
  • resource:none
  • range:8.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!stealthed.all&cooldown.shadow_dance.charges_fractional<=2.45&((combo_points.deficit>=4-(time<10)*2&energy.deficit>50+talent.vigor.enabled*25-(time>=10)*15)|target.time_to_die<8)
Spelldata
  • id:209782
  • name:Goremaw's Bite
  • school:physical
  • tooltip:
  • description:Lashes out at the target, inflicting ${$209783sw2+$209784sw2} Shadow damage and reducing movement speed by {$209786s1=60}% for {$209786d=8 seconds}. Grants $220901o2 Energy over {$220901d=6 seconds}. |cFFFFFFFFAwards {$220901s1=3} combo $lpoint:points;.|r
 
    Goremaw's Bite (_mh) 6682 1.1% 4.7 63.50sec 432134 0 Direct 4.7 348356 696840 432107 24.0% 0.0%  

Stats details: goremaws_bite_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.66 4.66 0.00 0.00 0.0000 0.0000 2013976.25 2013976.25 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 3.54 75.96% 348355.67 272066 359127 347396.90 0 359127 1233219 1233219 0.00
crit 1.12 24.04% 696840.43 544132 718254 497017.38 0 718254 780757 780757 0.00
 
 

Action details: goremaws_bite_mh

Static Values
  • id:209783
  • school:shadow
  • resource:none
  • range:8.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:209783
  • name:Goremaw's Bite
  • school:shadow
  • tooltip:
  • description:{$@spelldesc209782=Lashes out at the target, inflicting ${$209783sw2+$209784sw2} Shadow damage and reducing movement speed by {$209786s1=60}% for {$209786d=8 seconds}. Grants $220901o2 Energy over {$220901d=6 seconds}. |cFFFFFFFFAwards {$220901s1=3} combo $lpoint:points;.|r}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:10.00
 
    Goremaw's Bite (_oh) 3328 0.6% 4.7 63.50sec 215080 0 Direct 4.7 174180 348480 215067 23.5% 0.0%  

Stats details: goremaws_bite_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.66 4.66 0.00 0.00 0.0000 0.0000 1002388.52 1002388.52 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 3.57 76.53% 174179.56 136039 179572 173688.28 0 179572 621285 621285 0.00
crit 1.09 23.47% 348479.51 272079 359144 247381.18 0 359144 381104 381104 0.00
 
 

Action details: goremaws_bite_oh

Static Values
  • id:209784
  • school:shadow
  • resource:none
  • range:8.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:209784
  • name:Goremaw's Bite
  • school:shadow
  • tooltip:
  • description:{$@spelldesc209782=Lashes out at the target, inflicting ${$209783sw2+$209784sw2} Shadow damage and reducing movement speed by {$209786s1=60}% for {$209786d=8 seconds}. Grants $220901o2 Energy over {$220901d=6 seconds}. |cFFFFFFFFAwards {$220901s1=3} combo $lpoint:points;.|r}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:10.00
 
Mark of the Hidden Satyr 8748 1.5% 16.3 18.13sec 161047 0 Direct 16.3 130398 260845 161049 23.5% 0.0%  

Stats details: mark_of_the_hidden_satyr

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.34 16.34 0.00 0.00 0.0000 0.0000 2632097.39 2632097.39 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 12.50 76.50% 130397.76 100276 132364 130422.81 121334 132364 1630419 1630419 0.00
crit 3.84 23.50% 260844.74 200552 264729 255970.90 0 264729 1001678 1001678 0.00
 
 

Action details: mark_of_the_hidden_satyr

Static Values
  • id:191259
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191259
  • name:Mark of the Hidden Satyr
  • school:fire
  • tooltip:
  • description:Deals fire damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:2.500000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Nightblade 119239 20.0% 17.1 17.51sec 2103407 2094088 Periodic 144.6 200917 401827 248280 23.6% 0.0% 96.0%

Stats details: nightblade

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.07 0.00 144.65 144.65 1.0045 2.0000 35913608.25 35913608.25 0.00 117192.77 2094087.94
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 110.5 76.43% 200917.10 137013 224267 200967.51 194811 207310 22211400 22211400 0.00
crit 34.1 23.57% 401827.34 274025 448534 401936.59 374609 435254 13702209 13702209 0.00
 
 

Action details: nightblade

Static Values
  • id:195452
  • school:shadow
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:25.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:target.time_to_die>8&((refreshable&(!finality|buff.finality_nightblade.up))|remains<tick_time)
Spelldata
  • id:195452
  • name:Nightblade
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec and snared by attacks.
  • description:Finishing move that infects the target with shadowy energy, dealing Shadow damage over time and causing attacks against the target to reduce movement speed by {$206760s1=30}% for {$206760d=8 seconds}. Lasts longer per combo point. 1 point : ${$m1*8/2} over 8 sec 2 points: ${$m1*10/2} over 10 sec 3 points: ${$m1*12/2} over 12 sec 4 points: ${$m1*14/2} over 14 sec 5 points: ${$m1*16/2} over 16 sec{$?s193531=false}[ 6 points: ${$m1*18/2} over 18 sec][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:1.380000
  • spell_power_mod.tick:0.000000
  • base_td:1.00
  • dot_duration:6.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Potion of the Old War 18528 3.0% 23.1 8.00sec 236665 0 Direct 23.1 191643 383194 236660 23.5% 0.0%  

Stats details: potion_of_the_old_war

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.14 23.14 0.00 0.00 0.0000 0.0000 5476054.53 8050318.86 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.70 76.50% 191642.89 146122 192882 191633.24 184845 192882 3392065 4986657 31.98
crit 5.44 23.50% 383193.57 292245 385763 382298.58 0 385763 2083990 3063662 31.90
 
 

Action details: potion_of_the_old_war

Static Values
  • id:188028
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188028
  • name:Potion of the Old War
  • school:physical
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:135920.00
  • base_dd_max:203880.00
 
Recursive Strikes 39437 6.6% 80.5 4.79sec 147178 0 Direct 80.5 119037 238378 147182 23.6% 0.0%  

Stats details: recursive_strikes

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 80.53 80.53 0.00 0.00 0.0000 0.0000 11851723.36 17423155.97 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 61.54 76.42% 119036.75 24772 174395 117834.70 78232 153929 7324716 10768026 31.98
crit 18.99 23.58% 238378.00 49544 348790 235874.84 108997 326566 4527007 6655130 31.98
 
 

Action details: recursive_strikes

Static Values
  • id:225739
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:225739
  • name:Recursive Strikes
  • school:physical
  • tooltip:
  • description:{$@spelldesc225135=Your attacks have a chance to grant Recursive Strikes for {$225736d=15 seconds}, causing your auto attacks to deal an additional {$225736s1=3602} damage and increase the intensity of Recursive Strikes.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:9601.48
  • base_dd_max:9601.48
 
Shadow Blades 0 (15495) 0.0% (2.6%) 2.1 180.20sec 2186381 0

Stats details: shadow_blades

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.10 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: shadow_blades

Static Values
  • id:121471
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:combo_points<=2|(equipped.denial_of_the_halfgiants&combo_points>=1)
Spelldata
  • id:121471
  • name:Shadow Blades
  • school:physical
  • tooltip:Autoattacks deal pure Shadow damage. Combo-point-generating attacks generate {$s2=1} additional combo point.
  • description:Draws upon surrounding shadows to empower your weapons, causing auto attacks to deal Shadow damage and abilities that generate combo points to generate 1 additional combo point. Lasts {$d=15 seconds}.
 
    Shadow Blade (_mh) 10331 1.7% 66.4 3.61sec 46001 31721 Direct 66.4 37202 74403 46002 23.7% 0.0%  

Stats details: shadow_blade_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 66.44 66.44 0.00 0.00 1.4502 0.0000 3056365.39 3056365.39 0.00 31720.50 31720.50
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 50.73 76.35% 37201.75 28397 37484 37199.51 36247 37484 1887070 1887070 0.00
crit 15.72 23.65% 74403.22 56794 74969 74400.95 71124 74969 1169295 1169295 0.00
 
 

Action details: shadow_blade_mh

Static Values
  • id:121473
  • school:shadow
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:121473
  • name:Shadow Blade
  • school:shadow
  • tooltip:
  • description:Strike with dark energy, dealing Shadow damage equal to {$s1=1}% weapon damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
    Shadow Blade Off-hand 5164 0.9% 66.4 3.61sec 22999 15859 Direct 66.4 18600 37209 22999 23.6% 0.0%  

Stats details: shadow_blade_offhand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 66.44 66.44 0.00 0.00 1.4502 0.0000 1528080.95 1528080.95 0.00 15859.19 15859.19
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 50.73 76.36% 18599.73 14199 18742 18598.66 18198 18742 943637 943637 0.00
crit 15.71 23.64% 37208.98 28397 37484 37206.96 35591 37484 584444 584444 0.00
 
 

Action details: shadow_blade_offhand

Static Values
  • id:121474
  • school:shadow
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:121474
  • name:Shadow Blade Off-hand
  • school:shadow
  • tooltip:
  • description:Strike with dark energy, dealing Shadow damage equal to {$s1=1}% weapon damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Shadow Nova 10929 1.8% 32.1 9.57sec 102056 0 Direct 32.1 82590 165177 102056 23.6% 0.0%  

Stats details: shadow_nova

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 32.14 32.14 0.00 0.00 0.0000 0.0000 3280026.75 3280026.75 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 24.56 76.43% 82590.37 68830 82595 82590.55 81831 82595 2028792 2028792 0.00
crit 7.58 23.57% 165177.01 137659 165191 165142.17 0 165191 1251235 1251235 0.00
 
 

Action details: shadow_nova

Static Values
  • id:197800
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:5.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:197800
  • name:Shadow Nova
  • school:shadow
  • tooltip:
  • description:Deals {$s1=0} Shadow damage to enemies with $A1 yards.
 
Shadowstrike 120787 (148872) 20.2% (24.8%) 104.5 2.89sec 427178 425269 Direct 104.5 260253 520522 346581 33.2% 0.0%  

Stats details: shadowstrike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 104.51 104.51 0.00 0.00 1.0045 0.0000 36222233.10 53250113.72 31.98 425268.73 425268.73
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 69.85 66.83% 260252.73 216893 260271 260253.52 258129 260271 18178280 26723793 31.98
crit 34.67 33.17% 520521.69 433785 520542 520520.90 514116 520542 18043953 26526320 31.98
 
 

Action details: shadowstrike

Static Values
  • id:185438
  • school:physical
  • resource:energy
  • range:15.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:185438
  • name:Shadowstrike
  • school:physical
  • tooltip:
  • description:Strike through the shadows, $?a231718[appearing behind your target and ][]dealing $sw2 Physical damage. |cFFFFFFFFAwards {$s3=1} combo $lpoint:points;.|r
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:8.50
 
    Soul Rip 28085 4.7% 103.9 2.86sec 81047 0 Direct 103.9 65553 131106 81047 23.6% 0.0%  

Stats details: soul_rip

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 103.94 103.94 0.00 0.00 0.0000 0.0000 8423754.47 8423754.47 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 79.37 76.37% 65553.23 65553 65553 65553.23 65553 65553 5203083 5203083 0.00
crit 24.57 23.63% 131106.47 131106 131106 131106.47 131106 131106 3220671 3220671 0.00
 
 

Action details: soul_rip

Static Values
  • id:220893
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:220893
  • name:Soul Rip
  • school:shadow
  • tooltip:
  • description:{$@spelldesc209835=After using Shadowstrike or Cheap Shot, Akaari's Soul appears $m1 sec later and Soul Rips your target, dealing {$220893s1=1} Shadow damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:1.500000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Simple Action Stats Execute Interval
AD+NF
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:AD+NF
  • harmful:false
  • if_expr:
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:AD+NF
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:AD+NF
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Shadow Dance 26.2 11.50sec

Stats details: shadow_dance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 26.24 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: shadow_dance

Static Values
  • id:185313
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:charges_fractional>=2.45
Spelldata
  • id:185313
  • name:Shadow Dance
  • school:physical
  • tooltip:
  • description:Allows use of all Stealth abilities and grants all the combat benefits of Stealth for {$d=3 seconds}. Effect not broken from taking damage or attacking. {$?s14062=false}[Movement speed while active is increased by {$1784s3=0}% and damage dealt is increased by {$1784s4=0}%. ]?s108209[Abilities cost {$112942s1=75}% less while active. ][]{$?s31223=false}[Attacks from Shadow Dance and for {$31223s1=5} sec after deal {$31665s1=10}% more damage. ][]
 
Sprint 2.7 122.21sec

Stats details: sprint

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.74 0.00 86.77 0.00 0.0000 0.2500 0.00 0.00 0.00 0.00 0.00
 
 

Action details: sprint

Static Values
  • id:2983
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:2983
  • name:Sprint
  • school:physical
  • tooltip:Movement speed increased by $w1%.
  • description:Increases your movement speed by {$s1=70}% for {$d=8 seconds}. Usable while stealthed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:0.25
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Symbols of Death 13.2 23.92sec

Stats details: symbols_of_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.21 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: symbols_of_death

Static Values
  • id:212283
  • school:physical
  • resource:energy
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:10.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:212283
  • name:Symbols of Death
  • school:physical
  • tooltip:All damage done increased by {$s1=20}%.
  • description:Invoke ancient symbols of power, increasing all damage you deal by {$s1=20}% for {$d=35 seconds}, and causing your next Shadowstrike to critically strike. Unaffected by the global cooldown.
 
Vanish 2.8 122.16sec

Stats details: vanish

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.85 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: vanish

Static Values
  • id:1856
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:1856
  • name:Vanish
  • school:physical
  • tooltip:Improved stealth.
  • description:Allows you to vanish from sight, entering stealth while in combat. For the first {$11327d=3 seconds} after vanishing, damage and harmful effects received will not break stealth. Also breaks movement impairing effects.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 37.53% 0.0(0.0) 1.0

Buff details

  • buff initial source:AD+NF
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Death 13.2 0.0 22.9sec 24.0sec 1.64% 12.44% 0.0(0.0) 0.2

Buff details

  • buff initial source:AD+NF
  • cooldown name:buff_death
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • death_1:1.64%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:227151
  • name:Death
  • tooltip:Your next Shadowstrike will critically strike.
  • description:{$@spelldesc212283=Invoke ancient symbols of power, increasing all damage you deal by {$s1=20}% for {$d=35 seconds}, and causing your next Shadowstrike to critically strike. Unaffected by the global cooldown.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Faster Than Light Trigger 2.7 0.0 122.3sec 122.3sec 2.72% 2.72% 0.0(0.0) 2.7

Buff details

  • buff initial source:AD+NF
  • cooldown name:buff_faster_than_light_trigger
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • faster_than_light_trigger_1:2.72%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:197270
  • name:Faster Than Light Trigger
  • tooltip:
  • description:
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
Finality: Eviscerate 26.8 0.0 11.2sec 11.2sec 49.08% 49.52% 0.0(0.0) 0.0

Buff details

  • buff initial source:AD+NF
  • cooldown name:buff_finality_eviscerate
  • max_stacks:10
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.04

Stack Uptimes

  • finality_eviscerate_5:22.51%
  • finality_eviscerate_6:26.56%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:197496
  • name:Finality: Eviscerate
  • tooltip:Your next Eviscerate will do $w1% increased damage.
  • description:
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Finality: Nightblade 8.7 0.0 35.2sec 35.2sec 42.92% 41.05% 0.0(0.0) 0.0

Buff details

  • buff initial source:AD+NF
  • cooldown name:buff_finality_nightblade
  • max_stacks:6
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.04

Stack Uptimes

  • finality_nightblade_5:17.58%
  • finality_nightblade_6:25.34%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:197498
  • name:Finality: Nightblade
  • tooltip:Your next Nightblade will do $w1% increased damage.
  • description:
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Goremaw's Bite 4.7 0.0 63.5sec 63.5sec 9.18% 9.18% 27.6(27.6) 4.6

Buff details

  • buff initial source:AD+NF
  • cooldown name:buff_goremaws_bite
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • goremaws_bite_1:9.18%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:220901
  • name:Goremaw's Bite
  • tooltip:Generating {$s2=5} Energy every $t2 sec.
  • description:{$@spelldesc209782=Lashes out at the target, inflicting ${$209783sw2+$209784sw2} Shadow damage and reducing movement speed by {$209786s1=60}% for {$209786d=8 seconds}. Grants $220901o2 Energy over {$220901d=6 seconds}. |cFFFFFFFFAwards {$220901s1=3} combo $lpoint:points;.|r}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Master of Subtlety 36.9 1.4 8.2sec 7.9sec 34.59% 46.01% 1.4(1.4) 12.8

Buff details

  • buff initial source:AD+NF
  • cooldown name:buff_master_of_subtlety
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • master_of_subtlety_1:34.59%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:31223
  • name:Master of Subtlety
  • tooltip:
  • description:Attacks made while stealthed and for {$s1=5} seconds after breaking stealth cause an additional {$31665s1=10}% damage.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Master of Subtlety (_aura) 37.0 1.4 8.2sec 8.0sec 48.48% 36.38% 1.4(1.4) 0.0

Buff details

  • buff initial source:AD+NF
  • cooldown name:buff_master_of_subtlety_aura
  • max_stacks:1
  • duration:150.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • master_of_subtlety_aura_1:48.48%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:31223
  • name:Master of Subtlety
  • tooltip:
  • description:Attacks made while stealthed and for {$s1=5} seconds after breaking stealth cause an additional {$31665s1=10}% damage.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of the Old War 2.0 0.0 150.1sec 0.0sec 16.24% 16.24% 0.0(0.0) 2.0

Buff details

  • buff initial source:AD+NF
  • cooldown name:buff_potion_of_the_old_war
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_the_old_war_1:16.24%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188028
  • name:Potion of the Old War
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Recursive Strikes 4.5 81.7 61.0sec 2.7sec 24.49% 100.00% 21.5(21.5) 4.2

Buff details

  • buff initial source:AD+NF
  • cooldown name:buff_recursive_strikes
  • max_stacks:15
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • recursive_strikes_1:0.88%
  • recursive_strikes_2:1.19%
  • recursive_strikes_3:1.52%
  • recursive_strikes_4:1.21%
  • recursive_strikes_5:1.47%
  • recursive_strikes_6:1.23%
  • recursive_strikes_7:1.44%
  • recursive_strikes_8:1.25%
  • recursive_strikes_9:1.42%
  • recursive_strikes_10:1.25%
  • recursive_strikes_11:1.39%
  • recursive_strikes_12:1.21%
  • recursive_strikes_13:1.34%
  • recursive_strikes_14:1.10%
  • recursive_strikes_15:6.61%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225736
  • name:Recursive Strikes
  • tooltip:Your auto attacks deal an additional $w1 damage and increase the potency of this effect.
  • description:{$@spelldesc225135=Your attacks have a chance to grant Recursive Strikes for {$225736d=15 seconds}, causing your auto attacks to deal an additional {$225736s1=3602} damage and increase the intensity of Recursive Strikes.}
  • max_stacks:15
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Shadow Blades 2.1 0.0 180.2sec 180.2sec 34.62% 39.79% 0.0(0.0) 2.0

Buff details

  • buff initial source:AD+NF
  • cooldown name:buff_shadow_blades
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • shadow_blades_1:34.62%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:121471
  • name:Shadow Blades
  • tooltip:Autoattacks deal pure Shadow damage. Combo-point-generating attacks generate {$s2=1} additional combo point.
  • description:Draws upon surrounding shadows to empower your weapons, causing auto attacks to deal Shadow damage and abilities that generate combo points to generate 1 additional combo point. Lasts {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Shadow Dance 26.2 0.0 11.5sec 11.5sec 43.43% 43.43% 0.0(0.0) 25.9

Buff details

  • buff initial source:AD+NF
  • cooldown name:buff_shadow_dance
  • max_stacks:1
  • duration:5.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • shadow_dance_1:43.43%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:185313
  • name:Shadow Dance
  • tooltip:
  • description:Allows use of all Stealth abilities and grants all the combat benefits of Stealth for {$d=3 seconds}. Effect not broken from taking damage or attacking. {$?s14062=false}[Movement speed while active is increased by {$1784s3=0}% and damage dealt is increased by {$1784s4=0}%. ]?s108209[Abilities cost {$112942s1=75}% less while active. ][]{$?s31223=false}[Attacks from Shadow Dance and for {$31223s1=5} sec after deal {$31665s1=10}% more damage. ][]
  • max_stacks:0
  • duration:3.00
  • cooldown:1.00
  • default_chance:0.00%
Sprint 2.7 0.0 122.3sec 122.3sec 7.20% 7.20% 86.8(86.8) 2.7

Buff details

  • buff initial source:AD+NF
  • cooldown name:buff_sprint
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • sprint_1:7.20%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2983
  • name:Sprint
  • tooltip:Movement speed increased by $w1%.
  • description:Increases your movement speed by {$s1=70}% for {$d=8 seconds}. Usable while stealthed.
  • max_stacks:0
  • duration:8.00
  • cooldown:120.00
  • default_chance:0.00%
Stealth 6.5 0.0 44.9sec 52.1sec 1.03% 1.03% 0.0(0.0) 0.0

Buff details

  • buff initial source:AD+NF
  • cooldown name:buff_stealth
  • max_stacks:1
  • duration:150.00
  • cooldown:2.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stealth_1:1.03%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:1784
  • name:Stealth
  • tooltip:Stealthed.$?$w3!=0[ Movement speed increased by $w3%.][]$?$w4!=0[ Damage increased by $w4%.][]
  • description:Conceals you in the shadows until cancelled, allowing you to stalk enemies without being seen. {$?s14062=false}[Movement speed while stealthed is increased by {$s3=0}% and damage dealt is increased by {$s4=0}%.]?s108209[ Abilities cost {$112942s1=75}% less while stealthed. ][]{$?s31223=false}[ Attacks from Stealth and for {$31223s1=5} sec after deal {$31665s1=10}% more damage.][]
  • max_stacks:0
  • duration:-0.00
  • cooldown:2.00
  • default_chance:100.00%
Subterfuge 6.6 0.0 44.6sec 52.2sec 6.55% 6.55% 0.0(0.0) 6.5

Buff details

  • buff initial source:AD+NF
  • cooldown name:buff_subterfuge
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • subterfuge_1:6.55%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:115192
  • name:Subterfuge
  • tooltip:Temporarily concealed in the shadows.
  • description:{$@spelldesc108208=Your abilities requiring Stealth can still be used for {$115192d=3 seconds} after Stealth breaks.$?c3[ Also increases the duration of Shadow Dance by ${$m2/1000} sec.][ Also causes Garrote to deal {$115192s2=125}% increased damage and have no cooldown when used from Stealth or {$115192d=3 seconds} after Stealth breaks.]}
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
Symbols of Death 1.2 12.0 190.8sec 24.0sec 99.79% 99.31% 12.0(12.0) 0.3

Buff details

  • buff initial source:AD+NF
  • cooldown name:buff_symbols_of_death
  • max_stacks:1
  • duration:35.00
  • cooldown:10.00
  • default_chance:100.00%
  • default_value:1.20

Stack Uptimes

  • symbols_of_death_1:99.79%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:212283
  • name:Symbols of Death
  • tooltip:All damage done increased by {$s1=20}%.
  • description:Invoke ancient symbols of power, increasing all damage you deal by {$s1=20}% for {$d=35 seconds}, and causing your next Shadowstrike to critically strike. Unaffected by the global cooldown.
  • max_stacks:0
  • duration:35.00
  • cooldown:10.00
  • default_chance:0.00%
Temptation 1.9 4.0 177.0sec 43.4sec 36.54% 66.96% 0.0(0.0) 1.4

Buff details

  • buff initial source:AD+NF
  • cooldown name:buff_temptation
  • max_stacks:10
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • temptation_1:9.64%
  • temptation_2:9.72%
  • temptation_3:9.28%
  • temptation_4:7.73%
  • temptation_5:0.18%
  • temptation_6:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:234143
  • name:Temptation
  • tooltip:Increased chance for your Ring of Collapsing Futures to incur a {$s1=5} min cooldown.
  • description:{$@spelldesc234142=Deal {$s1=40000} Shadow damage to an enemy.}
  • max_stacks:10
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Vanish 5.6 0.0 52.0sec 52.0sec 5.54% 5.54% 0.0(0.0) 5.5

Buff details

  • buff initial source:AD+NF
  • cooldown name:buff_vanish
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • vanish_1:5.54%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:11327
  • name:Vanish
  • tooltip:Improved stealth.$?$w3!=0[ Movement speed increased by $w3%.][]$?$w4!=0[ Damage increased by $w4%.][]
  • description:
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:AD+NF
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Seventh Demon

Buff details

  • buff initial source:AD+NF
  • cooldown name:buff_flask_of_the_seventh_demon
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:1300.00

Stack Uptimes

  • flask_of_the_seventh_demon_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188033
  • name:Flask of the Seventh Demon
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (seedbattered_fish_plate)

Buff details

  • buff initial source:AD+NF
  • cooldown name:buff_seedbattered_fish_plate
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:versatility_rating
  • amount:375.00

Stack Uptimes

  • seedbattered_fish_plate_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225605
  • name:Well Fed
  • tooltip:Versatility increased by $w1.
  • description:Increases versatility by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
AD+NF
backstab Energy 51.2 1792.9 35.0 35.0 4855.9
eviscerate Energy 53.2 1861.6 35.0 35.0 27587.5
eviscerate Combo Points 53.2 296.3 5.6 5.6 173314.9
nightblade Energy 17.1 426.8 25.0 25.0 84136.6
nightblade Combo Points 17.1 95.2 5.6 5.6 377329.0
shadowstrike Energy 104.5 4180.6 40.0 40.0 10679.3
symbols_of_death Energy 13.2 427.3 32.4 32.3 0.0
Resource Gains Type Count Total Average Overflow
backstab Combo Points 51.23 51.23 (12.99%) 1.00 0.00 0.00%
goremaws_bite Combo Points 4.66 13.83 (3.51%) 2.97 0.15 1.06%
shadowstrike Combo Points 104.52 209.03 (53.01%) 2.00 0.00 0.00%
energy_regen Energy 1185.88 3340.31 (38.71%) 2.82 90.62 2.64%
Shadow Techniques Combo Points 72.01 71.08 (18.03%) 0.99 15.28 17.69%
Master of Shadows Energy 37.35 788.97 (9.14%) 21.12 144.76 15.50%
Shadow Blades Combo Points 58.68 49.13 (12.46%) 0.84 9.55 16.28%
Energetic Stabbing Energy 26.08 652.08 (7.56%) 25.00 0.00 0.00%
Goremaw's Bite Energy 27.63 135.17 (1.57%) 4.89 2.97 2.15%
Relentless Strikes Energy 70.26 3085.63 (35.76%) 43.92 47.66 1.52%
Shadow Satyr's Walk Energy 104.52 627.09 (7.27%) 6.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Energy 28.64 28.84
Combo Points 1.31 1.30
Combat End Resource Mean Min Max
Energy 39.52 6.08 100.00
Combo Points 2.84 0.00 6.00

Benefits & Uptimes

Benefits %
Uptimes %
Energy Cap 1.4%

Statistics & Data Analysis

Fight Length
Sample Data AD+NF Fight Length
Count 4999
Mean 301.28
Minimum 222.03
Maximum 381.32
Spread ( max - min ) 159.29
Range [ ( max - min ) / 2 * 100% ] 26.44%
DPS
Sample Data AD+NF Damage Per Second
Count 4999
Mean 598883.99
Minimum 507125.32
Maximum 712140.29
Spread ( max - min ) 205014.97
Range [ ( max - min ) / 2 * 100% ] 17.12%
Standard Deviation 28805.5714
5th Percentile 554577.99
95th Percentile 648500.42
( 95th Percentile - 5th Percentile ) 93922.43
Mean Distribution
Standard Deviation 407.4130
95.00% Confidence Intervall ( 598085.48 - 599682.51 )
Normalized 95.00% Confidence Intervall ( 99.87% - 100.13% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 89
0.1% Error 8888
0.1 Scale Factor Error with Delta=300 7083317
0.05 Scale Factor Error with Delta=300 28333267
0.01 Scale Factor Error with Delta=300 708331667
Priority Target DPS
Sample Data AD+NF Priority Target Damage Per Second
Count 4999
Mean 598883.99
Minimum 507125.32
Maximum 712140.29
Spread ( max - min ) 205014.97
Range [ ( max - min ) / 2 * 100% ] 17.12%
Standard Deviation 28805.5714
5th Percentile 554577.99
95th Percentile 648500.42
( 95th Percentile - 5th Percentile ) 93922.43
Mean Distribution
Standard Deviation 407.4130
95.00% Confidence Intervall ( 598085.48 - 599682.51 )
Normalized 95.00% Confidence Intervall ( 99.87% - 100.13% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 89
0.1% Error 8888
0.1 Scale Factor Error with Delta=300 7083317
0.05 Scale Factor Error with Delta=300 28333267
0.01 Scale Factor Error with Delta=300 708331667
DPS(e)
Sample Data AD+NF Damage Per Second (Effective)
Count 4999
Mean 598883.99
Minimum 507125.32
Maximum 712140.29
Spread ( max - min ) 205014.97
Range [ ( max - min ) / 2 * 100% ] 17.12%
Damage
Sample Data AD+NF Damage
Count 4999
Mean 179752546.21
Minimum 128338047.79
Maximum 233585399.36
Spread ( max - min ) 105247351.57
Range [ ( max - min ) / 2 * 100% ] 29.28%
DTPS
Sample Data AD+NF Damage Taken Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data AD+NF Healing Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data AD+NF Healing Per Second (Effective)
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data AD+NF Heal
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data AD+NF Healing Taken Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data AD+NF Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data AD+NFTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data AD+NF Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,name=flask_of_the_seventh_demon
1 0.00 augmentation,name=defiled
2 0.00 food,name=seedbattered_fish_plate
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 stealth
5 0.00 potion,name=old_war
6 0.00 marked_for_death,if=raid_event.adds.in>40
7 0.00 variable,name=ssw_refund,value=equipped.shadow_satyrs_walk*(4+ssw_refund_offset)
Defined variables that doesn't change during the fight
8 0.00 variable,name=stealth_threshold,value=(15+talent.vigor.enabled*35+talent.master_of_shadows.enabled*30+variable.ssw_refund)
9 0.00 enveloping_shadows,if=combo_points>=5
A 0.00 symbols_of_death
Default action list Executed every time the actor is available.
# count action,conditions
B 0.00 call_action_list,name=cds
C 0.00 run_action_list,name=stealthed,if=stealthed.all
Fully switch to the Stealthed Rotation (by doing so, it forces pooling if nothing is available)
D 0.00 call_action_list,name=finish,if=combo_points>=5|(combo_points>=4&spell_targets.shuriken_storm>=3&spell_targets.shuriken_storm<=4)
E 0.00 call_action_list,name=stealth_als,if=combo_points.deficit>=2+talent.premeditation.enabled
F 0.00 call_action_list,name=build,if=energy.deficit<=variable.stealth_threshold
actions.build Builders
# count action,conditions
0.00 shuriken_storm,if=spell_targets.shuriken_storm>=2
0.00 gloomblade
G 51.23 backstab
actions.cds Cooldowns
# count action,conditions
H 1.00 potion,name=old_war,if=buff.bloodlust.react|target.time_to_die<=25|buff.shadow_blades.up
I 5.81 use_item,slot=finger2,if=(buff.shadow_blades.up&stealthed.rogue)|target.time_to_die<20
0.00 blood_fury,if=stealthed.rogue
0.00 berserking,if=stealthed.rogue
0.00 arcane_torrent,if=stealthed.rogue&energy.deficit>70
J 2.10 shadow_blades,if=combo_points<=2|(equipped.denial_of_the_halfgiants&combo_points>=1)
K 4.66 goremaws_bite,if=!stealthed.all&cooldown.shadow_dance.charges_fractional<=2.45&((combo_points.deficit>=4-(time<10)*2&energy.deficit>50+talent.vigor.enabled*25-(time>=10)*15)|target.time_to_die<8)
0.00 marked_for_death,target_if=min:target.time_to_die,if=target.time_to_die<combo_points.deficit|(raid_event.adds.in>40&combo_points.deficit>=4+talent.deeper_strategem.enabled+talent.anticipation.enabled)
actions.finish Finishers
# count action,conditions
0.00 enveloping_shadows,if=buff.enveloping_shadows.remains<target.time_to_die&buff.enveloping_shadows.remains<=combo_points*1.8
0.00 death_from_above,if=spell_targets.death_from_above>=6
L 17.07 nightblade,cycle_targets=1,if=target.time_to_die>8&((refreshable&(!finality|buff.finality_nightblade.up))|remains<tick_time)
0.00 death_from_above
M 53.19 eviscerate
actions.stealth_cds Stealth Cooldowns
# count action,conditions
R 3.67 shadow_dance,if=charges_fractional>=2.45
S 2.85 vanish
T 2.74 sprint_offensive
U 4.52 shadow_dance,if=charges>=2&combo_points<=1
0.00 pool_resource,for_next=1,extra_amount=40
0.00 shadowmeld,if=energy>=40&energy.deficit>=10+variable.ssw_refund
V 18.05 shadow_dance,if=combo_points<=1
actions.stealthed Stealthed Rotation
# count action,conditions
W 12.21 symbols_of_death,if=(buff.symbols_of_death.remains<target.time_to_die-4&buff.symbols_of_death.remains<=buff.symbols_of_death.duration*0.3)|equipped.shadow_satyrs_walk&energy.time_to_max<0.25
X 0.00 call_action_list,name=finish,if=combo_points>=5
0.00 shuriken_storm,if=buff.shadowmeld.down&((combo_points.deficit>=3&spell_targets.shuriken_storm>=2+talent.premeditation.enabled+equipped.shadow_satyrs_walk)|buff.the_dreadlords_deceit.stack>=29)
Y 104.52 shadowstrike

Sample Sequence

0124578AJIYYLRYYMYYMSYYMRWYYMIYYLGTGGMYYMRWYYMYIMUYYMWYYLGGMUYYMYIYMKGMGGLRWYYMYYMUYYMYYMUYYYMYGGLUYYMYGMVYWYLYGMVYYYMYGMVYYYLWYGMKGMVYYYMWYGLGVYYMYYGMSYYMGTGGYLYGGMVYYMYGLVWYYMGGGGMVYYLYYJHGMKGMVIYYMYYLVWYYMYMGGMVIYYMYYMGGLVWYYMYGMGGGLVYYMYGGMKGLVWYYMYSYMYGGLTVYYYMYYGMGGIGMVYYLYYGMGVYIYMG

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask AD+NF 100.0/100: 100% energy | 0.0/6: 0% combo_points
Pre precombat 1 augmentation AD+NF 100.0/100: 100% energy | 0.0/6: 0% combo_points
Pre precombat 2 food AD+NF 100.0/100: 100% energy | 0.0/6: 0% combo_points
Pre precombat 4 stealth Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, stealth
Pre precombat 5 potion Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, stealth, potion_of_the_old_war
Pre precombat 7 ssw_refund Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, stealth, potion_of_the_old_war
Pre precombat 8 stealth_threshold Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, stealth, potion_of_the_old_war
Pre precombat A symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, stealth, symbols_of_death, death, potion_of_the_old_war
0:00.000 cds J shadow_blades Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, stealth, symbols_of_death, death, potion_of_the_old_war
0:00.000 cds I use_item_ring_of_collapsing_futures Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, stealth, symbols_of_death, shadow_blades, death, potion_of_the_old_war
0:00.000 stealthed Y shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points temptation, master_of_subtlety_aura, stealth, symbols_of_death, shadow_blades, death, potion_of_the_old_war
0:01.006 stealthed Y shadowstrike Fluffy_Pillow 80.3/100: 80% energy | 3.0/6: 50% combo_points bloodlust, temptation, master_of_subtlety_aura, stealth, subterfuge, symbols_of_death, shadow_blades, recursive_strikes, potion_of_the_old_war
0:02.011 finish L nightblade Fluffy_Pillow 60.6/100: 61% energy | 6.0/6: 100% combo_points bloodlust, temptation, master_of_subtlety_aura, stealth, subterfuge, symbols_of_death, shadow_blades, recursive_strikes(3), potion_of_the_old_war
0:03.016 stealth_cds R shadow_dance Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points bloodlust, temptation, master_of_subtlety, symbols_of_death, shadow_blades, finality_nightblade(6), recursive_strikes(5), potion_of_the_old_war
0:03.016 stealthed Y shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points bloodlust, temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6), recursive_strikes(5), potion_of_the_old_war
0:04.019 stealthed Y shadowstrike Fluffy_Pillow 80.3/100: 80% energy | 3.0/6: 50% combo_points bloodlust, temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6), recursive_strikes(6), potion_of_the_old_war
0:05.024 finish M eviscerate Fluffy_Pillow 60.6/100: 61% energy | 6.0/6: 100% combo_points bloodlust, temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6), recursive_strikes(8), potion_of_the_old_war
0:06.029 stealthed Y shadowstrike Fluffy_Pillow 79.9/100: 80% energy | 0.0/6: 0% combo_points bloodlust, temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6), recursive_strikes(10), potion_of_the_old_war
0:07.034 stealthed Y shadowstrike Fluffy_Pillow 60.2/100: 60% energy | 4.0/6: 67% combo_points bloodlust, temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6), recursive_strikes(12), potion_of_the_old_war
0:08.040 finish M eviscerate Fluffy_Pillow 40.5/100: 41% energy | 6.0/6: 100% combo_points bloodlust, temptation, master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6), recursive_strikes(14), potion_of_the_old_war
0:09.044 stealth_cds S vanish Fluffy_Pillow 59.8/100: 60% energy | 0.0/6: 0% combo_points bloodlust, temptation, master_of_subtlety, symbols_of_death, shadow_blades, finality_nightblade(6), recursive_strikes(14), potion_of_the_old_war
0:09.044 stealthed Y shadowstrike Fluffy_Pillow 84.8/100: 85% energy | 0.0/6: 0% combo_points bloodlust, temptation, master_of_subtlety_aura, vanish, symbols_of_death, shadow_blades, finality_nightblade(6), recursive_strikes(14), potion_of_the_old_war
0:10.049 stealthed Y shadowstrike Fluffy_Pillow 65.2/100: 65% energy | 3.0/6: 50% combo_points bloodlust, temptation, master_of_subtlety_aura, vanish, subterfuge, symbols_of_death, shadow_blades, finality_nightblade(6), recursive_strikes(14), potion_of_the_old_war
0:11.053 finish M eviscerate Fluffy_Pillow 45.5/100: 45% energy | 6.0/6: 100% combo_points bloodlust, temptation, master_of_subtlety_aura, vanish, subterfuge, symbols_of_death, shadow_blades, finality_nightblade(6), recursive_strikes(15), potion_of_the_old_war
0:12.059 stealth_cds R shadow_dance Fluffy_Pillow 89.8/100: 90% energy | 1.0/6: 17% combo_points bloodlust, temptation, master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6), recursive_strikes(15), potion_of_the_old_war
0:12.059 stealthed W symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points bloodlust, temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6), recursive_strikes(15), potion_of_the_old_war
0:12.059 stealthed Y shadowstrike Fluffy_Pillow 65.0/100: 65% energy | 1.0/6: 17% combo_points bloodlust, temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, death, finality_eviscerate(6), finality_nightblade(6), recursive_strikes(15), potion_of_the_old_war
0:13.064 stealthed Y shadowstrike Fluffy_Pillow 45.3/100: 45% energy | 4.0/6: 67% combo_points bloodlust, temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6), recursive_strikes(15), potion_of_the_old_war
0:14.068 finish M eviscerate Fluffy_Pillow 50.6/100: 51% energy | 6.0/6: 100% combo_points bloodlust, temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6), recursive_strikes(15), potion_of_the_old_war
0:15.073 cds I use_item_ring_of_collapsing_futures Fluffy_Pillow 69.9/100: 70% energy | 1.0/6: 17% combo_points bloodlust, temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6), recursive_strikes(15), potion_of_the_old_war
0:15.073 stealthed Y shadowstrike Fluffy_Pillow 69.9/100: 70% energy | 1.0/6: 17% combo_points bloodlust, temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6), recursive_strikes(15), potion_of_the_old_war
0:16.076 stealthed Y shadowstrike Fluffy_Pillow 75.2/100: 75% energy | 4.0/6: 67% combo_points bloodlust, temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6), recursive_strikes(15), potion_of_the_old_war
0:17.079 finish L nightblade Fluffy_Pillow 80.5/100: 80% energy | 6.0/6: 100% combo_points bloodlust, temptation(2), master_of_subtlety, symbols_of_death, shadow_blades, finality_nightblade(6), recursive_strikes(15), potion_of_the_old_war
0:18.083 build G backstab Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points bloodlust, temptation(2), master_of_subtlety, symbols_of_death, shadow_blades, potion_of_the_old_war
0:19.088 stealth_cds T sprint Fluffy_Pillow 79.3/100: 79% energy | 2.0/6: 33% combo_points bloodlust, temptation(2), master_of_subtlety, symbols_of_death, shadow_blades, potion_of_the_old_war
0:19.088 build G backstab Fluffy_Pillow 79.3/100: 79% energy | 2.0/6: 33% combo_points bloodlust, temptation(2), master_of_subtlety, sprint, symbols_of_death, shadow_blades, faster_than_light_trigger, potion_of_the_old_war
0:20.091 build G backstab Fluffy_Pillow 58.6/100: 59% energy | 4.0/6: 67% combo_points bloodlust, temptation(2), master_of_subtlety, sprint, symbols_of_death, shadow_blades, faster_than_light_trigger, potion_of_the_old_war
0:21.096 finish M eviscerate Fluffy_Pillow 37.9/100: 38% energy | 6.0/6: 100% combo_points bloodlust, temptation(2), master_of_subtlety, sprint, symbols_of_death, shadow_blades, faster_than_light_trigger, potion_of_the_old_war
0:22.101 stealthed Y shadowstrike Fluffy_Pillow 82.2/100: 82% energy | 0.0/6: 0% combo_points bloodlust, temptation(2), master_of_subtlety_aura, vanish, subterfuge, sprint, symbols_of_death, shadow_blades, finality_eviscerate(6), recursive_strikes(3), potion_of_the_old_war
0:23.107 stealthed Y shadowstrike Fluffy_Pillow 62.5/100: 63% energy | 3.0/6: 50% combo_points bloodlust, temptation(2), master_of_subtlety_aura, vanish, subterfuge, sprint, symbols_of_death, shadow_blades, finality_eviscerate(6), recursive_strikes(3)
0:24.112 finish M eviscerate Fluffy_Pillow 42.9/100: 43% energy | 6.0/6: 100% combo_points bloodlust, temptation(2), master_of_subtlety_aura, vanish, subterfuge, sprint, symbols_of_death, shadow_blades, finality_eviscerate(6), recursive_strikes(5)
0:25.118 stealth_cds R shadow_dance Fluffy_Pillow 87.2/100: 87% energy | 0.0/6: 0% combo_points bloodlust, temptation(2), master_of_subtlety, sprint, symbols_of_death, shadow_blades, recursive_strikes(7)
0:25.118 stealthed W symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points bloodlust, temptation(2), master_of_subtlety_aura, shadow_dance, sprint, symbols_of_death, shadow_blades, recursive_strikes(7)
0:25.118 stealthed Y shadowstrike Fluffy_Pillow 65.0/100: 65% energy | 0.0/6: 0% combo_points bloodlust, temptation(2), master_of_subtlety_aura, shadow_dance, sprint, symbols_of_death, shadow_blades, death, recursive_strikes(7)
0:26.123 stealthed Y shadowstrike Fluffy_Pillow 45.3/100: 45% energy | 4.0/6: 67% combo_points bloodlust, temptation(2), master_of_subtlety_aura, shadow_dance, sprint, symbols_of_death, shadow_blades, recursive_strikes(9)
0:27.127 Waiting     0.700 sec 25.6/100: 26% energy | 6.0/6: 100% combo_points bloodlust, temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, recursive_strikes(9)
0:27.827 finish M eviscerate Fluffy_Pillow 35.6/100: 36% energy | 6.0/6: 100% combo_points bloodlust, temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, recursive_strikes(12)
0:28.831 stealthed Y shadowstrike Fluffy_Pillow 54.9/100: 55% energy | 1.0/6: 17% combo_points bloodlust, temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), recursive_strikes(14)
0:29.835 cds I use_item_ring_of_collapsing_futures Fluffy_Pillow 35.2/100: 35% energy | 4.0/6: 67% combo_points bloodlust, temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), recursive_strikes(15)
0:30.073 Waiting     0.900 sec 38.6/100: 39% energy | 4.0/6: 67% combo_points bloodlust, temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), recursive_strikes(15)
0:30.973 finish M eviscerate Fluffy_Pillow 51.4/100: 51% energy | 5.0/6: 83% combo_points bloodlust, temptation(3), master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), recursive_strikes(15)
0:31.977 stealth_cds U shadow_dance Fluffy_Pillow 70.7/100: 71% energy | 0.0/6: 0% combo_points bloodlust, temptation(3), master_of_subtlety, symbols_of_death, shadow_blades, recursive_strikes(15)
0:31.977 stealthed Y shadowstrike Fluffy_Pillow 95.7/100: 96% energy | 0.0/6: 0% combo_points bloodlust, temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, recursive_strikes(15)
0:32.982 stealthed Y shadowstrike Fluffy_Pillow 76.0/100: 76% energy | 3.0/6: 50% combo_points bloodlust, temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, recursive_strikes(15)
0:33.985 finish M eviscerate Fluffy_Pillow 56.3/100: 56% energy | 6.0/6: 100% combo_points bloodlust, temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, recursive_strikes(15)
0:34.989 stealthed W symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points bloodlust, temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), recursive_strikes(15)
0:35.118 stealthed Y shadowstrike Fluffy_Pillow 65.0/100: 65% energy | 0.0/6: 0% combo_points bloodlust, temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, death, finality_eviscerate(6), recursive_strikes(15)
0:36.122 stealthed Y shadowstrike Fluffy_Pillow 45.3/100: 45% energy | 3.0/6: 50% combo_points bloodlust, temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), recursive_strikes(15)
0:37.126 finish L nightblade Fluffy_Pillow 25.6/100: 26% energy | 6.0/6: 100% combo_points bloodlust, temptation(3), master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), recursive_strikes(15)
0:38.131 build G backstab Fluffy_Pillow 94.9/100: 95% energy | 2.0/6: 33% combo_points bloodlust, temptation(3), master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6), recursive_strikes(15)
0:39.136 build G backstab Fluffy_Pillow 74.2/100: 74% energy | 4.0/6: 67% combo_points bloodlust, temptation(3), master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6), recursive_strikes(15)
0:40.141 finish M eviscerate Fluffy_Pillow 53.5/100: 54% energy | 6.0/6: 100% combo_points bloodlust, temptation(3), master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6), recursive_strikes(15)
0:41.146 stealth_cds U shadow_dance Fluffy_Pillow 69.5/100: 70% energy | 0.0/6: 0% combo_points temptation(3), master_of_subtlety, symbols_of_death, shadow_blades, finality_nightblade(6), recursive_strikes(15)
0:41.146 stealthed Y shadowstrike Fluffy_Pillow 94.5/100: 95% energy | 0.0/6: 0% combo_points temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6), recursive_strikes(15)
0:42.150 stealthed Y shadowstrike Fluffy_Pillow 96.5/100: 97% energy | 3.0/6: 50% combo_points temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6)
0:43.154 finish M eviscerate Fluffy_Pillow 73.5/100: 74% energy | 6.0/6: 100% combo_points temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6)
0:44.159 stealthed Y shadowstrike Fluffy_Pillow 89.6/100: 90% energy | 0.0/6: 0% combo_points temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6)
0:45.164 cds I use_item_ring_of_collapsing_futures Fluffy_Pillow 66.6/100: 67% energy | 3.0/6: 50% combo_points temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6)
0:45.164 stealthed Y shadowstrike Fluffy_Pillow 66.6/100: 67% energy | 3.0/6: 50% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6)
0:46.168 finish M eviscerate Fluffy_Pillow 43.6/100: 44% energy | 6.0/6: 100% combo_points temptation(4), master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6)
0:47.174 cds K goremaws_bite Fluffy_Pillow 59.6/100: 60% energy | 0.0/6: 0% combo_points temptation(4), master_of_subtlety, symbols_of_death, shadow_blades, finality_nightblade(6)
0:48.180 build G backstab Fluffy_Pillow 75.6/100: 76% energy | 4.0/6: 67% combo_points temptation(4), master_of_subtlety, symbols_of_death, shadow_blades, goremaws_bite, finality_nightblade(6)
0:49.185 finish M eviscerate Fluffy_Pillow 56.6/100: 57% energy | 6.0/6: 100% combo_points temptation(4), master_of_subtlety, symbols_of_death, shadow_blades, goremaws_bite, finality_nightblade(6)
0:50.191 build G backstab Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points temptation(4), master_of_subtlety, symbols_of_death, shadow_blades, goremaws_bite, finality_eviscerate(6), finality_nightblade(6)
0:51.195 build G backstab Fluffy_Pillow 81.0/100: 81% energy | 4.0/6: 67% combo_points temptation(4), symbols_of_death, shadow_blades, goremaws_bite, finality_eviscerate(6), finality_nightblade(6)
0:52.201 finish L nightblade Fluffy_Pillow 62.0/100: 62% energy | 6.0/6: 100% combo_points temptation(4), symbols_of_death, shadow_blades, goremaws_bite, finality_eviscerate(6), finality_nightblade(6)
0:53.208 stealth_cds R shadow_dance Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points temptation(4), symbols_of_death, shadow_blades, finality_eviscerate(6)
0:53.208 stealthed W symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6)
0:53.208 stealthed Y shadowstrike Fluffy_Pillow 65.0/100: 65% energy | 0.0/6: 0% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, death, finality_eviscerate(6)
0:54.210 stealthed Y shadowstrike Fluffy_Pillow 42.0/100: 42% energy | 4.0/6: 67% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6)
0:55.215 finish M eviscerate Fluffy_Pillow 44.0/100: 44% energy | 6.0/6: 100% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6)
0:56.219 stealthed Y shadowstrike Fluffy_Pillow 60.0/100: 60% energy | 0.0/6: 0% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades
0:57.224 Waiting     0.300 sec 37.0/100: 37% energy | 3.0/6: 50% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death
0:57.524 stealthed Y shadowstrike Fluffy_Pillow 40.3/100: 40% energy | 3.0/6: 50% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death
0:58.532 Waiting     1.700 sec 17.3/100: 17% energy | 5.0/6: 83% combo_points temptation(4), master_of_subtlety, symbols_of_death
1:00.232 finish M eviscerate Fluffy_Pillow 35.9/100: 36% energy | 5.0/6: 83% combo_points temptation(4), master_of_subtlety, symbols_of_death
1:01.237 stealth_cds U shadow_dance Fluffy_Pillow 52.0/100: 52% energy | 1.0/6: 17% combo_points temptation(4), master_of_subtlety, symbols_of_death, finality_eviscerate(5)
1:01.237 stealthed Y shadowstrike Fluffy_Pillow 77.0/100: 77% energy | 1.0/6: 17% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5)
1:02.243 stealthed Y shadowstrike Fluffy_Pillow 54.0/100: 54% energy | 3.0/6: 50% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5)
1:03.247 Waiting     0.400 sec 31.0/100: 31% energy | 5.0/6: 83% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5)
1:03.647 finish M eviscerate Fluffy_Pillow 35.4/100: 35% energy | 5.0/6: 83% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5)
1:04.652 stealthed Y shadowstrike Fluffy_Pillow 51.4/100: 51% energy | 0.0/6: 0% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death
1:05.657 stealthed Y shadowstrike Fluffy_Pillow 53.4/100: 53% energy | 2.0/6: 33% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death
1:06.662 Waiting     0.500 sec 30.4/100: 30% energy | 6.0/6: 100% combo_points temptation(4), master_of_subtlety, symbols_of_death
1:07.162 finish M eviscerate Fluffy_Pillow 35.9/100: 36% energy | 6.0/6: 100% combo_points temptation(4), master_of_subtlety, symbols_of_death
1:08.167 stealth_cds U shadow_dance Fluffy_Pillow 51.9/100: 52% energy | 0.0/6: 0% combo_points temptation(4), master_of_subtlety, symbols_of_death, finality_eviscerate(6)
1:08.167 stealthed Y shadowstrike Fluffy_Pillow 76.9/100: 77% energy | 0.0/6: 0% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6)
1:09.173 stealthed Y shadowstrike Fluffy_Pillow 78.9/100: 79% energy | 2.0/6: 33% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6)
1:10.177 stealthed Y shadowstrike Fluffy_Pillow 55.9/100: 56% energy | 4.0/6: 67% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6)
1:11.181 Waiting     0.200 sec 32.9/100: 33% energy | 6.0/6: 100% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6)
1:11.381 finish M eviscerate Fluffy_Pillow 35.1/100: 35% energy | 6.0/6: 100% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6)
1:12.384 stealthed Y shadowstrike Fluffy_Pillow 51.1/100: 51% energy | 0.0/6: 0% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death
1:13.388 build G backstab Fluffy_Pillow 53.1/100: 53% energy | 2.0/6: 33% combo_points temptation(4), master_of_subtlety, symbols_of_death
1:14.393 Waiting     2.100 sec 29.1/100: 29% energy | 4.0/6: 67% combo_points temptation(4), master_of_subtlety, symbols_of_death
1:16.493 build G backstab Fluffy_Pillow 52.1/100: 52% energy | 4.0/6: 67% combo_points master_of_subtlety, symbols_of_death
1:17.497 finish L nightblade Fluffy_Pillow 28.1/100: 28% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death
1:18.500 stealth_cds U shadow_dance Fluffy_Pillow 54.1/100: 54% energy | 0.0/6: 0% combo_points symbols_of_death, finality_nightblade(5)
1:18.500 stealthed Y shadowstrike Fluffy_Pillow 79.1/100: 79% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(5)
1:19.504 stealthed Y shadowstrike Fluffy_Pillow 56.1/100: 56% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(5)
1:20.508 Waiting     0.200 sec 33.1/100: 33% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(5), recursive_strikes(2)
1:20.708 finish M eviscerate Fluffy_Pillow 35.3/100: 35% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(5), recursive_strikes(2)
1:21.712 stealthed Y shadowstrike Fluffy_Pillow 51.3/100: 51% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6), finality_nightblade(5), recursive_strikes(2)
1:22.716 Waiting     2.100 sec 28.3/100: 28% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6), finality_nightblade(5), recursive_strikes(3)
1:24.816 build G backstab Fluffy_Pillow 51.3/100: 51% energy | 4.0/6: 67% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(6), finality_nightblade(5), recursive_strikes(5)
1:25.821 Waiting     0.800 sec 27.3/100: 27% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(6), finality_nightblade(5), recursive_strikes(7)
1:26.621 finish M eviscerate Fluffy_Pillow 36.0/100: 36% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(6), finality_nightblade(5), recursive_strikes(7)
1:27.625 stealth_cds V shadow_dance Fluffy_Pillow 52.0/100: 52% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, finality_nightblade(5), recursive_strikes(9)
1:27.625 stealthed Y shadowstrike Fluffy_Pillow 77.0/100: 77% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(5), recursive_strikes(9)
1:28.630 stealthed W symbols_of_death Fluffy_Pillow 79.0/100: 79% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(5), recursive_strikes(9)
1:28.630 stealthed Y shadowstrike Fluffy_Pillow 44.0/100: 44% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, death, finality_nightblade(5), recursive_strikes(9)
1:29.634 Waiting     0.461 sec 21.0/100: 21% energy | 5.0/6: 83% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(5), recursive_strikes(10)
1:30.095 finish L nightblade Fluffy_Pillow 26.1/100: 26% energy | 5.0/6: 83% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(5), recursive_strikes(10)
1:31.098 stealthed Y shadowstrike Fluffy_Pillow 52.1/100: 52% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, recursive_strikes(12)
1:32.104 Waiting     2.000 sec 29.1/100: 29% energy | 3.0/6: 50% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, recursive_strikes(14)
1:34.104 build G backstab Fluffy_Pillow 51.0/100: 51% energy | 3.0/6: 50% combo_points master_of_subtlety, symbols_of_death, recursive_strikes(15)
1:35.110 Waiting     1.800 sec 27.0/100: 27% energy | 4.0/6: 67% combo_points master_of_subtlety, symbols_of_death
1:36.910 finish M eviscerate Fluffy_Pillow 46.8/100: 47% energy | 6.0/6: 100% combo_points master_of_subtlety, symbols_of_death
1:37.915 stealth_cds V shadow_dance Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points symbols_of_death, finality_eviscerate(6)
1:37.915 stealthed Y shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6)
1:38.919 stealthed Y shadowstrike Fluffy_Pillow 77.0/100: 77% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6)
1:39.924 stealthed Y shadowstrike Fluffy_Pillow 54.0/100: 54% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6)
1:40.928 Waiting     0.400 sec 31.0/100: 31% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6)
1:41.328 finish M eviscerate Fluffy_Pillow 35.4/100: 35% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6)
1:42.332 stealthed Y shadowstrike Fluffy_Pillow 51.4/100: 51% energy | 1.0/6: 17% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
1:43.336 build G backstab Fluffy_Pillow 53.4/100: 53% energy | 3.0/6: 50% combo_points master_of_subtlety, symbols_of_death
1:44.340 Waiting     0.800 sec 29.4/100: 29% energy | 4.0/6: 67% combo_points master_of_subtlety, symbols_of_death
1:45.140 finish M eviscerate Fluffy_Pillow 38.1/100: 38% energy | 6.0/6: 100% combo_points master_of_subtlety, symbols_of_death
1:46.146 stealth_cds V shadow_dance Fluffy_Pillow 54.2/100: 54% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(6)
1:46.146 stealthed Y shadowstrike Fluffy_Pillow 79.2/100: 79% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6)
1:47.152 stealthed Y shadowstrike Fluffy_Pillow 56.2/100: 56% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6)
1:48.155 stealthed Y shadowstrike Fluffy_Pillow 58.2/100: 58% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6)
1:49.160 finish L nightblade Fluffy_Pillow 35.2/100: 35% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6)
1:50.163 stealthed W symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6), finality_nightblade(6)
1:50.163 stealthed Y shadowstrike Fluffy_Pillow 65.0/100: 65% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, death, finality_eviscerate(6), finality_nightblade(6)
1:51.167 Waiting     0.900 sec 42.0/100: 42% energy | 4.0/6: 67% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(6), finality_nightblade(6)
1:52.067 build G backstab Fluffy_Pillow 51.9/100: 52% energy | 4.0/6: 67% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(6), finality_nightblade(6)
1:53.071 Waiting     0.700 sec 27.9/100: 28% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(6), finality_nightblade(6)
1:53.771 finish M eviscerate Fluffy_Pillow 35.5/100: 36% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(6), finality_nightblade(6)
1:54.777 cds K goremaws_bite Fluffy_Pillow 51.5/100: 52% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, finality_nightblade(6)
1:55.782 build G backstab Fluffy_Pillow 67.6/100: 68% energy | 3.0/6: 50% combo_points master_of_subtlety, symbols_of_death, goremaws_bite, finality_nightblade(6)
1:56.787 finish M eviscerate Fluffy_Pillow 48.6/100: 49% energy | 6.0/6: 100% combo_points symbols_of_death, goremaws_bite, finality_nightblade(6)
1:57.790 stealth_cds V shadow_dance Fluffy_Pillow 69.6/100: 70% energy | 0.0/6: 0% combo_points symbols_of_death, goremaws_bite, finality_eviscerate(6), finality_nightblade(6)
1:57.790 stealthed Y shadowstrike Fluffy_Pillow 94.6/100: 95% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, goremaws_bite, finality_eviscerate(6), finality_nightblade(6)
1:58.793 stealthed Y shadowstrike Fluffy_Pillow 76.5/100: 77% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, goremaws_bite, finality_eviscerate(6), finality_nightblade(6)
1:59.798 stealthed Y shadowstrike Fluffy_Pillow 83.6/100: 84% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, goremaws_bite, finality_eviscerate(6), finality_nightblade(6)
2:00.802 finish M eviscerate Fluffy_Pillow 65.5/100: 66% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6), finality_nightblade(6)
2:01.809 stealthed W symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(6)
2:01.809 stealthed Y shadowstrike Fluffy_Pillow 65.0/100: 65% energy | 1.0/6: 17% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, death, finality_nightblade(6)
2:02.815 Waiting     0.900 sec 42.0/100: 42% energy | 3.0/6: 50% combo_points master_of_subtlety, symbols_of_death, finality_nightblade(6)
2:03.715 build G backstab Fluffy_Pillow 51.9/100: 52% energy | 3.0/6: 50% combo_points master_of_subtlety, symbols_of_death, finality_nightblade(6)
2:04.721 Waiting     1.800 sec 27.9/100: 28% energy | 4.0/6: 67% combo_points master_of_subtlety, symbols_of_death, finality_nightblade(6)
2:06.521 finish L nightblade Fluffy_Pillow 47.6/100: 48% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death, finality_nightblade(6)
2:07.526 build G backstab Fluffy_Pillow 73.6/100: 74% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death
2:08.530 stealth_cds V shadow_dance Fluffy_Pillow 49.6/100: 50% energy | 1.0/6: 17% combo_points symbols_of_death
2:08.530 stealthed Y shadowstrike Fluffy_Pillow 74.6/100: 75% energy | 1.0/6: 17% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
2:09.535 stealthed Y shadowstrike Fluffy_Pillow 76.6/100: 77% energy | 3.0/6: 50% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
2:10.539 finish M eviscerate Fluffy_Pillow 78.6/100: 79% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
2:11.543 stealthed Y shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6)
2:12.548 stealthed Y shadowstrike Fluffy_Pillow 77.0/100: 77% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6)
2:13.553 build G backstab Fluffy_Pillow 79.0/100: 79% energy | 4.0/6: 67% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(6)
2:14.557 finish M eviscerate Fluffy_Pillow 55.0/100: 55% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(6)
2:15.562 stealth_cds S vanish Fluffy_Pillow 71.0/100: 71% energy | 1.0/6: 17% combo_points master_of_subtlety, symbols_of_death
2:15.562 stealthed Y shadowstrike Fluffy_Pillow 96.0/100: 96% energy | 1.0/6: 17% combo_points master_of_subtlety_aura, vanish, symbols_of_death
2:16.565 stealthed Y shadowstrike Fluffy_Pillow 73.0/100: 73% energy | 3.0/6: 50% combo_points master_of_subtlety_aura, vanish, subterfuge, symbols_of_death
2:17.571 finish M eviscerate Fluffy_Pillow 50.0/100: 50% energy | 5.0/6: 83% combo_points master_of_subtlety_aura, vanish, subterfuge, symbols_of_death
2:18.576 build G backstab Fluffy_Pillow 91.0/100: 91% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5)
2:19.581 stealth_cds T sprint Fluffy_Pillow 67.1/100: 67% energy | 2.0/6: 33% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5)
2:19.581 build G backstab Fluffy_Pillow 67.1/100: 67% energy | 2.0/6: 33% combo_points master_of_subtlety, sprint, symbols_of_death, finality_eviscerate(5), faster_than_light_trigger
2:20.586 Waiting     0.800 sec 43.1/100: 43% energy | 3.0/6: 50% combo_points master_of_subtlety, sprint, symbols_of_death, finality_eviscerate(5), faster_than_light_trigger
2:21.386 build G backstab Fluffy_Pillow 51.8/100: 52% energy | 3.0/6: 50% combo_points master_of_subtlety, sprint, symbols_of_death, finality_eviscerate(5), faster_than_light_trigger
2:22.391 Waiting     0.200 sec 27.8/100: 28% energy | 4.0/6: 67% combo_points master_of_subtlety, sprint, symbols_of_death, finality_eviscerate(5), faster_than_light_trigger
2:22.591 stealthed Y shadowstrike Fluffy_Pillow 55.0/100: 55% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, vanish, subterfuge, sprint, symbols_of_death, finality_eviscerate(5)
2:23.595 finish L nightblade Fluffy_Pillow 32.0/100: 32% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, vanish, subterfuge, sprint, symbols_of_death, finality_eviscerate(5)
2:24.600 stealthed Y shadowstrike Fluffy_Pillow 58.0/100: 58% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, vanish, subterfuge, sprint, symbols_of_death, finality_eviscerate(5), finality_nightblade(6)
2:25.605 build G backstab Fluffy_Pillow 60.0/100: 60% energy | 2.0/6: 33% combo_points master_of_subtlety, sprint, symbols_of_death, finality_eviscerate(5), finality_nightblade(6)
2:26.610 Waiting     1.400 sec 36.1/100: 36% energy | 4.0/6: 67% combo_points master_of_subtlety, sprint, symbols_of_death, finality_eviscerate(5), finality_nightblade(6)
2:28.010 build G backstab Fluffy_Pillow 51.4/100: 51% energy | 4.0/6: 67% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5), finality_nightblade(6)
2:29.013 Waiting     0.700 sec 27.4/100: 27% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5), finality_nightblade(6)
2:29.713 finish M eviscerate Fluffy_Pillow 35.1/100: 35% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5), finality_nightblade(6)
2:30.718 stealth_cds V shadow_dance Fluffy_Pillow 51.1/100: 51% energy | 0.0/6: 0% combo_points symbols_of_death, finality_nightblade(6)
2:30.718 stealthed Y shadowstrike Fluffy_Pillow 76.1/100: 76% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(6)
2:31.725 stealthed Y shadowstrike Fluffy_Pillow 53.1/100: 53% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(6)
2:32.729 Waiting     0.500 sec 30.1/100: 30% energy | 5.0/6: 83% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(6)
2:33.229 finish M eviscerate Fluffy_Pillow 35.6/100: 36% energy | 5.0/6: 83% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(6)
2:34.233 stealthed Y shadowstrike Fluffy_Pillow 51.6/100: 52% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5), finality_nightblade(6)
2:35.237 Waiting     2.100 sec 28.6/100: 29% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5), finality_nightblade(6)
2:37.337 build G backstab Fluffy_Pillow 51.6/100: 52% energy | 4.0/6: 67% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5), finality_nightblade(6)
2:38.341 finish L nightblade Fluffy_Pillow 27.6/100: 28% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5), finality_nightblade(6), recursive_strikes(3)
2:39.347 stealth_cds V shadow_dance Fluffy_Pillow 53.6/100: 54% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5), recursive_strikes(4)
2:39.347 stealthed W symbols_of_death Fluffy_Pillow 78.6/100: 79% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5), recursive_strikes(4)
2:39.347 stealthed Y shadowstrike Fluffy_Pillow 43.6/100: 44% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, death, finality_eviscerate(5), recursive_strikes(4)
2:40.350 Waiting     1.803 sec 20.6/100: 21% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5), recursive_strikes(4)
2:42.153 stealthed Y shadowstrike Fluffy_Pillow 40.3/100: 40% energy | 3.0/6: 50% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5), recursive_strikes(6)
2:43.158 Waiting     1.699 sec 17.3/100: 17% energy | 5.0/6: 83% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5), recursive_strikes(8)
2:44.857 finish M eviscerate Fluffy_Pillow 36.0/100: 36% energy | 6.0/6: 100% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5), recursive_strikes(10)
2:45.860 build G backstab Fluffy_Pillow 91.9/100: 92% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, recursive_strikes(11)
2:46.864 build G backstab Fluffy_Pillow 67.9/100: 68% energy | 1.0/6: 17% combo_points master_of_subtlety, symbols_of_death, recursive_strikes(11)
2:47.867 Waiting     0.700 sec 43.9/100: 44% energy | 2.0/6: 33% combo_points master_of_subtlety, symbols_of_death, recursive_strikes(12)
2:48.567 build G backstab Fluffy_Pillow 51.6/100: 52% energy | 2.0/6: 33% combo_points master_of_subtlety, symbols_of_death, recursive_strikes(12)
2:49.572 Waiting     2.200 sec 27.6/100: 28% energy | 4.0/6: 67% combo_points symbols_of_death, recursive_strikes(14)
2:51.772 build G backstab Fluffy_Pillow 51.7/100: 52% energy | 4.0/6: 67% combo_points symbols_of_death, recursive_strikes(15)
2:52.778 Waiting     0.700 sec 27.7/100: 28% energy | 6.0/6: 100% combo_points symbols_of_death
2:53.478 finish M eviscerate Fluffy_Pillow 35.4/100: 35% energy | 6.0/6: 100% combo_points symbols_of_death
2:54.481 stealth_cds V shadow_dance Fluffy_Pillow 51.4/100: 51% energy | 0.0/6: 0% combo_points symbols_of_death, finality_eviscerate(6)
2:54.481 stealthed Y shadowstrike Fluffy_Pillow 76.4/100: 76% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6)
2:55.485 stealthed Y shadowstrike Fluffy_Pillow 53.4/100: 53% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6)
2:56.489 Waiting     0.600 sec 30.4/100: 30% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6)
2:57.089 finish L nightblade Fluffy_Pillow 37.0/100: 37% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6)
2:58.096 stealthed Y shadowstrike Fluffy_Pillow 63.0/100: 63% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6), finality_nightblade(6)
2:59.102 stealthed Y shadowstrike Fluffy_Pillow 40.0/100: 40% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6), finality_nightblade(6)
3:00.104 cds J shadow_blades Fluffy_Pillow 42.0/100: 42% energy | 4.0/6: 67% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(6), finality_nightblade(6)
3:00.104 cds H potion Fluffy_Pillow 42.0/100: 42% energy | 4.0/6: 67% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6)
3:00.104 Waiting     0.900 sec 42.0/100: 42% energy | 4.0/6: 67% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6), potion_of_the_old_war
3:01.004 build G backstab Fluffy_Pillow 51.8/100: 52% energy | 4.0/6: 67% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6), potion_of_the_old_war
3:02.007 Waiting     0.700 sec 27.8/100: 28% energy | 6.0/6: 100% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6), potion_of_the_old_war
3:02.707 finish M eviscerate Fluffy_Pillow 35.5/100: 35% energy | 6.0/6: 100% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6), potion_of_the_old_war
3:03.711 cds K goremaws_bite Fluffy_Pillow 51.5/100: 51% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_nightblade(6), potion_of_the_old_war
3:04.715 build G backstab Fluffy_Pillow 67.5/100: 67% energy | 3.0/6: 50% combo_points symbols_of_death, shadow_blades, goremaws_bite, finality_nightblade(6), potion_of_the_old_war
3:05.721 finish M eviscerate Fluffy_Pillow 48.5/100: 49% energy | 6.0/6: 100% combo_points symbols_of_death, shadow_blades, goremaws_bite, finality_nightblade(6), potion_of_the_old_war
3:06.726 stealth_cds V shadow_dance Fluffy_Pillow 69.5/100: 70% energy | 0.0/6: 0% combo_points symbols_of_death, shadow_blades, goremaws_bite, finality_eviscerate(6), finality_nightblade(6), potion_of_the_old_war
3:06.726 cds I use_item_ring_of_collapsing_futures Fluffy_Pillow 94.5/100: 95% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, goremaws_bite, finality_eviscerate(6), finality_nightblade(6), potion_of_the_old_war
3:06.726 stealthed Y shadowstrike Fluffy_Pillow 94.5/100: 95% energy | 0.0/6: 0% combo_points temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, goremaws_bite, finality_eviscerate(6), finality_nightblade(6), potion_of_the_old_war
3:07.730 stealthed Y shadowstrike Fluffy_Pillow 76.5/100: 77% energy | 3.0/6: 50% combo_points temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, goremaws_bite, finality_eviscerate(6), finality_nightblade(6), potion_of_the_old_war
3:08.736 finish M eviscerate Fluffy_Pillow 58.5/100: 59% energy | 6.0/6: 100% combo_points temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, goremaws_bite, finality_eviscerate(6), finality_nightblade(6), potion_of_the_old_war
3:09.740 stealthed Y shadowstrike Fluffy_Pillow 79.5/100: 80% energy | 0.0/6: 0% combo_points temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6), potion_of_the_old_war
3:10.746 stealthed Y shadowstrike Fluffy_Pillow 56.6/100: 57% energy | 3.0/6: 50% combo_points temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6), potion_of_the_old_war
3:11.753 finish L nightblade Fluffy_Pillow 33.6/100: 34% energy | 6.0/6: 100% combo_points temptation, master_of_subtlety, symbols_of_death, shadow_blades, finality_nightblade(6), potion_of_the_old_war
3:12.756 stealth_cds V shadow_dance Fluffy_Pillow 99.6/100: 100% energy | 1.0/6: 17% combo_points temptation, master_of_subtlety, symbols_of_death, shadow_blades, potion_of_the_old_war
3:12.756 stealthed W symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, potion_of_the_old_war
3:12.756 stealthed Y shadowstrike Fluffy_Pillow 65.0/100: 65% energy | 1.0/6: 17% combo_points temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, death, potion_of_the_old_war
3:13.762 stealthed Y shadowstrike Fluffy_Pillow 42.0/100: 42% energy | 4.0/6: 67% combo_points temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, potion_of_the_old_war
3:14.766 Waiting     1.545 sec 19.0/100: 19% energy | 6.0/6: 100% combo_points temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, potion_of_the_old_war
3:16.311 finish M eviscerate Fluffy_Pillow 35.9/100: 36% energy | 6.0/6: 100% combo_points temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, potion_of_the_old_war
3:17.318 stealthed Y shadowstrike Fluffy_Pillow 52.0/100: 52% energy | 1.0/6: 17% combo_points temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), potion_of_the_old_war
3:18.321 Waiting     1.800 sec 29.0/100: 29% energy | 4.0/6: 67% combo_points temptation, master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), potion_of_the_old_war
3:20.121 finish M eviscerate Fluffy_Pillow 48.7/100: 49% energy | 5.0/6: 83% combo_points temptation, master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), potion_of_the_old_war
3:21.126 build G backstab Fluffy_Pillow 64.7/100: 65% energy | 0.0/6: 0% combo_points temptation, master_of_subtlety, symbols_of_death, shadow_blades, potion_of_the_old_war
3:22.132 Waiting     1.000 sec 40.7/100: 41% energy | 2.0/6: 33% combo_points temptation, master_of_subtlety, symbols_of_death, shadow_blades, potion_of_the_old_war
3:23.132 build G backstab Fluffy_Pillow 51.7/100: 52% energy | 2.0/6: 33% combo_points temptation, symbols_of_death, shadow_blades, potion_of_the_old_war
3:24.136 Waiting     0.700 sec 27.7/100: 28% energy | 5.0/6: 83% combo_points temptation, symbols_of_death, shadow_blades, potion_of_the_old_war
3:24.836 finish M eviscerate Fluffy_Pillow 35.3/100: 35% energy | 5.0/6: 83% combo_points temptation, symbols_of_death, shadow_blades, potion_of_the_old_war
3:25.840 stealth_cds V shadow_dance Fluffy_Pillow 51.3/100: 51% energy | 0.0/6: 0% combo_points temptation, symbols_of_death, shadow_blades, finality_eviscerate(5)
3:25.840 cds I use_item_ring_of_collapsing_futures Fluffy_Pillow 76.3/100: 76% energy | 0.0/6: 0% combo_points temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(5)
3:25.840 stealthed Y shadowstrike Fluffy_Pillow 76.3/100: 76% energy | 0.0/6: 0% combo_points temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(5)
3:26.844 stealthed Y shadowstrike Fluffy_Pillow 53.3/100: 53% energy | 4.0/6: 67% combo_points temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(5)
3:27.848 Waiting     0.500 sec 30.3/100: 30% energy | 6.0/6: 100% combo_points temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(5)
3:28.348 finish M eviscerate Fluffy_Pillow 35.8/100: 36% energy | 6.0/6: 100% combo_points temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(5)
3:29.353 stealthed Y shadowstrike Fluffy_Pillow 91.8/100: 92% energy | 0.0/6: 0% combo_points temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades
3:30.358 stealthed Y shadowstrike Fluffy_Pillow 68.8/100: 69% energy | 4.0/6: 67% combo_points temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades
3:31.362 finish M eviscerate Fluffy_Pillow 45.8/100: 46% energy | 6.0/6: 100% combo_points temptation(2), master_of_subtlety, symbols_of_death, shadow_blades
3:32.367 build G backstab Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points temptation(2), master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6)
3:33.373 build G backstab Fluffy_Pillow 76.0/100: 76% energy | 3.0/6: 50% combo_points temptation(2), master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6)
3:34.377 finish L nightblade Fluffy_Pillow 52.0/100: 52% energy | 5.0/6: 83% combo_points temptation(2), master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6)
3:35.382 stealth_cds V shadow_dance Fluffy_Pillow 78.0/100: 78% energy | 0.0/6: 0% combo_points temptation(2), master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(5)
3:35.382 stealthed W symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(5)
3:35.382 stealthed Y shadowstrike Fluffy_Pillow 65.0/100: 65% energy | 0.0/6: 0% combo_points temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, death, finality_eviscerate(6), finality_nightblade(5)
3:36.386 stealthed Y shadowstrike Fluffy_Pillow 42.0/100: 42% energy | 3.0/6: 50% combo_points temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(5)
3:37.388 Waiting     1.549 sec 19.0/100: 19% energy | 6.0/6: 100% combo_points temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(5)
3:38.937 finish M eviscerate Fluffy_Pillow 35.9/100: 36% energy | 6.0/6: 100% combo_points temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(5)
3:39.941 stealthed Y shadowstrike Fluffy_Pillow 51.9/100: 52% energy | 0.0/6: 0% combo_points temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(5)
3:40.946 Waiting     2.100 sec 29.0/100: 29% energy | 3.0/6: 50% combo_points temptation(2), master_of_subtlety, symbols_of_death, shadow_blades, finality_nightblade(5)
3:43.046 build G backstab Fluffy_Pillow 52.0/100: 52% energy | 4.0/6: 67% combo_points temptation(2), master_of_subtlety, symbols_of_death, shadow_blades, finality_nightblade(5)
3:44.049 Waiting     0.700 sec 27.9/100: 28% energy | 6.0/6: 100% combo_points temptation(2), master_of_subtlety, symbols_of_death, finality_nightblade(5)
3:44.749 finish M eviscerate Fluffy_Pillow 35.6/100: 36% energy | 6.0/6: 100% combo_points temptation(2), master_of_subtlety, symbols_of_death, finality_nightblade(5)
3:45.754 build G backstab Fluffy_Pillow 51.6/100: 52% energy | 0.0/6: 0% combo_points temptation(2), symbols_of_death, finality_eviscerate(6), finality_nightblade(5)
3:46.759 Waiting     2.200 sec 27.6/100: 28% energy | 1.0/6: 17% combo_points temptation(2), symbols_of_death, finality_eviscerate(6), finality_nightblade(5)
3:48.959 build G backstab Fluffy_Pillow 51.7/100: 52% energy | 2.0/6: 33% combo_points temptation(2), symbols_of_death, finality_eviscerate(6), finality_nightblade(5)
3:49.966 Waiting     2.200 sec 27.8/100: 28% energy | 3.0/6: 50% combo_points temptation(2), symbols_of_death, finality_eviscerate(6), finality_nightblade(5)
3:52.166 build G backstab Fluffy_Pillow 51.9/100: 52% energy | 4.0/6: 67% combo_points temptation(2), symbols_of_death, finality_eviscerate(6), finality_nightblade(5)
3:53.170 finish L nightblade Fluffy_Pillow 27.9/100: 28% energy | 5.0/6: 83% combo_points temptation(2), symbols_of_death, finality_eviscerate(6), finality_nightblade(5)
3:54.174 stealth_cds V shadow_dance Fluffy_Pillow 53.9/100: 54% energy | 0.0/6: 0% combo_points temptation(2), symbols_of_death, finality_eviscerate(6)
3:54.174 stealthed Y shadowstrike Fluffy_Pillow 78.9/100: 79% energy | 0.0/6: 0% combo_points temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6)
3:55.178 stealthed Y shadowstrike Fluffy_Pillow 55.9/100: 56% energy | 2.0/6: 33% combo_points temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6)
3:56.182 Waiting     0.200 sec 32.9/100: 33% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6)
3:56.382 finish M eviscerate Fluffy_Pillow 35.1/100: 35% energy | 5.0/6: 83% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6)
3:57.386 stealthed Y shadowstrike Fluffy_Pillow 51.1/100: 51% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
3:58.391 Waiting     2.100 sec 28.1/100: 28% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
4:00.491 build G backstab Fluffy_Pillow 51.1/100: 51% energy | 2.0/6: 33% combo_points master_of_subtlety, symbols_of_death
4:01.496 Waiting     2.200 sec 27.1/100: 27% energy | 3.0/6: 50% combo_points master_of_subtlety, symbols_of_death
4:03.696 build G backstab Fluffy_Pillow 51.2/100: 51% energy | 4.0/6: 67% combo_points master_of_subtlety, symbols_of_death
4:04.702 Waiting     0.800 sec 27.2/100: 27% energy | 5.0/6: 83% combo_points symbols_of_death
4:05.502 finish M eviscerate Fluffy_Pillow 36.0/100: 36% energy | 5.0/6: 83% combo_points symbols_of_death
4:06.508 cds K goremaws_bite Fluffy_Pillow 52.0/100: 52% energy | 1.0/6: 17% combo_points symbols_of_death, finality_eviscerate(5)
4:07.512 build G backstab Fluffy_Pillow 68.0/100: 68% energy | 4.0/6: 67% combo_points symbols_of_death, goremaws_bite, finality_eviscerate(5)
4:08.518 finish L nightblade Fluffy_Pillow 49.0/100: 49% energy | 5.0/6: 83% combo_points symbols_of_death, goremaws_bite, finality_eviscerate(5)
4:09.523 stealth_cds V shadow_dance Fluffy_Pillow 80.0/100: 80% energy | 1.0/6: 17% combo_points symbols_of_death, goremaws_bite, finality_eviscerate(5), finality_nightblade(5), recursive_strikes(2)
4:09.523 stealthed W symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, goremaws_bite, finality_eviscerate(5), finality_nightblade(5), recursive_strikes(2)
4:09.523 stealthed Y shadowstrike Fluffy_Pillow 65.0/100: 65% energy | 1.0/6: 17% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, goremaws_bite, death, finality_eviscerate(5), finality_nightblade(5), recursive_strikes(2)
4:10.527 stealthed Y shadowstrike Fluffy_Pillow 47.0/100: 47% energy | 3.0/6: 50% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, goremaws_bite, finality_eviscerate(5), finality_nightblade(5), recursive_strikes(2)
4:11.531 Waiting     0.600 sec 29.0/100: 29% energy | 5.0/6: 83% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, goremaws_bite, finality_eviscerate(5), finality_nightblade(5), recursive_strikes(4)
4:12.131 finish M eviscerate Fluffy_Pillow 35.6/100: 36% energy | 5.0/6: 83% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, goremaws_bite, finality_eviscerate(5), finality_nightblade(5), recursive_strikes(4)
4:13.137 stealthed Y shadowstrike Fluffy_Pillow 56.6/100: 57% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(5), recursive_strikes(6)
4:14.140 Waiting     1.200 sec 33.6/100: 34% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(5), recursive_strikes(6)
4:15.340 stealth_cds S vanish Fluffy_Pillow 46.7/100: 47% energy | 3.0/6: 50% combo_points master_of_subtlety, symbols_of_death, finality_nightblade(5), recursive_strikes(8)
4:15.562 stealthed Y shadowstrike Fluffy_Pillow 74.2/100: 74% energy | 3.0/6: 50% combo_points master_of_subtlety_aura, vanish, symbols_of_death, finality_nightblade(5), recursive_strikes(8)
4:16.567 finish M eviscerate Fluffy_Pillow 51.2/100: 51% energy | 5.0/6: 83% combo_points master_of_subtlety_aura, vanish, subterfuge, symbols_of_death, finality_nightblade(5), recursive_strikes(10)
4:17.572 stealthed Y shadowstrike Fluffy_Pillow 67.2/100: 67% energy | 1.0/6: 17% combo_points master_of_subtlety_aura, vanish, subterfuge, symbols_of_death, finality_eviscerate(5), finality_nightblade(5), recursive_strikes(11)
4:18.576 build G backstab Fluffy_Pillow 69.2/100: 69% energy | 3.0/6: 50% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5), finality_nightblade(5), recursive_strikes(12)
4:19.581 Waiting     0.600 sec 45.2/100: 45% energy | 4.0/6: 67% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5), finality_nightblade(5), recursive_strikes(13)
4:20.181 build G backstab Fluffy_Pillow 51.8/100: 52% energy | 4.0/6: 67% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5), finality_nightblade(5), recursive_strikes(13)
4:21.186 finish L nightblade Fluffy_Pillow 27.8/100: 28% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5), finality_nightblade(5), recursive_strikes(13)
4:22.191 stealth_cds T sprint Fluffy_Pillow 53.8/100: 54% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5), recursive_strikes(15)
4:22.191 stealth_cds V shadow_dance Fluffy_Pillow 53.8/100: 54% energy | 0.0/6: 0% combo_points master_of_subtlety, sprint, symbols_of_death, finality_eviscerate(5), faster_than_light_trigger, recursive_strikes(15)
4:22.191 stealthed Y shadowstrike Fluffy_Pillow 78.8/100: 79% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, sprint, symbols_of_death, finality_eviscerate(5), faster_than_light_trigger, recursive_strikes(15)
4:23.196 stealthed Y shadowstrike Fluffy_Pillow 80.8/100: 81% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, sprint, symbols_of_death, finality_eviscerate(5), faster_than_light_trigger, recursive_strikes(15)
4:24.201 stealthed Y shadowstrike Fluffy_Pillow 57.8/100: 58% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, shadow_dance, sprint, symbols_of_death, finality_eviscerate(5), faster_than_light_trigger, recursive_strikes(15)
4:25.205 finish M eviscerate Fluffy_Pillow 59.8/100: 60% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, vanish, subterfuge, sprint, symbols_of_death, finality_eviscerate(5)
4:26.211 stealthed Y shadowstrike Fluffy_Pillow 75.8/100: 76% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, vanish, subterfuge, sprint, symbols_of_death
4:27.217 stealthed Y shadowstrike Fluffy_Pillow 52.8/100: 53% energy | 2.0/6: 33% combo_points master_of_subtlety, vanish, subterfuge, sprint, symbols_of_death
4:28.220 build G backstab Fluffy_Pillow 54.8/100: 55% energy | 4.0/6: 67% combo_points master_of_subtlety, sprint, symbols_of_death
4:29.225 Waiting     0.400 sec 30.8/100: 31% energy | 6.0/6: 100% combo_points master_of_subtlety, sprint, symbols_of_death
4:29.625 finish M eviscerate Fluffy_Pillow 35.2/100: 35% energy | 6.0/6: 100% combo_points master_of_subtlety, sprint, symbols_of_death
4:30.631 build G backstab Fluffy_Pillow 51.2/100: 51% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(6)
4:31.636 Waiting     2.200 sec 27.2/100: 27% energy | 1.0/6: 17% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(6)
4:33.836 build G backstab Fluffy_Pillow 51.3/100: 51% energy | 2.0/6: 33% combo_points symbols_of_death, finality_eviscerate(6)
4:34.841 cds I use_item_ring_of_collapsing_futures Fluffy_Pillow 27.4/100: 27% energy | 3.0/6: 50% combo_points symbols_of_death, finality_eviscerate(6)
4:34.841 Waiting     2.200 sec 27.4/100: 27% energy | 3.0/6: 50% combo_points temptation, symbols_of_death, finality_eviscerate(6)
4:37.041 build G backstab Fluffy_Pillow 51.5/100: 51% energy | 4.0/6: 67% combo_points temptation, symbols_of_death, finality_eviscerate(6)
4:38.047 Waiting     0.700 sec 27.5/100: 27% energy | 5.0/6: 83% combo_points temptation, symbols_of_death, finality_eviscerate(6)
4:38.747 finish M eviscerate Fluffy_Pillow 35.1/100: 35% energy | 5.0/6: 83% combo_points temptation, symbols_of_death, finality_eviscerate(6)
4:39.751 stealth_cds V shadow_dance Fluffy_Pillow 51.1/100: 51% energy | 0.0/6: 0% combo_points temptation, symbols_of_death
4:39.751 stealthed Y shadowstrike Fluffy_Pillow 76.1/100: 76% energy | 0.0/6: 0% combo_points temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death
4:40.755 stealthed Y shadowstrike Fluffy_Pillow 78.1/100: 78% energy | 3.0/6: 50% combo_points temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death
4:41.759 finish L nightblade Fluffy_Pillow 55.1/100: 55% energy | 5.0/6: 83% combo_points temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death
4:42.765 stealthed Y shadowstrike Fluffy_Pillow 81.2/100: 81% energy | 0.0/6: 0% combo_points temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(5)
4:43.768 stealthed Y shadowstrike Fluffy_Pillow 83.2/100: 83% energy | 2.0/6: 33% combo_points temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(5)
4:44.771 build G backstab Fluffy_Pillow 60.1/100: 60% energy | 4.0/6: 67% combo_points temptation, master_of_subtlety, symbols_of_death, finality_nightblade(5)
4:45.776 finish M eviscerate Fluffy_Pillow 36.1/100: 36% energy | 6.0/6: 100% combo_points temptation, master_of_subtlety, symbols_of_death, finality_nightblade(5)
4:46.782 build G backstab Fluffy_Pillow 52.2/100: 52% energy | 0.0/6: 0% combo_points temptation, master_of_subtlety, symbols_of_death, finality_eviscerate(6), finality_nightblade(5)
4:47.787 stealth_cds V shadow_dance Fluffy_Pillow 28.2/100: 28% energy | 1.0/6: 17% combo_points temptation, master_of_subtlety, symbols_of_death, finality_eviscerate(6), finality_nightblade(5)
4:47.787 stealthed Y shadowstrike Fluffy_Pillow 53.2/100: 53% energy | 1.0/6: 17% combo_points temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6), finality_nightblade(5)
4:48.791 Waiting     0.800 sec 30.2/100: 30% energy | 3.0/6: 50% combo_points temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6), finality_nightblade(5)
4:49.591 cds I use_item_ring_of_collapsing_futures Fluffy_Pillow 38.9/100: 39% energy | 3.0/6: 50% combo_points temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6), finality_nightblade(5)
4:49.841 stealthed Y shadowstrike Fluffy_Pillow 41.7/100: 42% energy | 3.0/6: 50% combo_points temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6), finality_nightblade(5)
4:50.848 Waiting     1.573 sec 18.7/100: 19% energy | 5.0/6: 83% combo_points temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6), finality_nightblade(5)
4:52.421 finish M eviscerate Fluffy_Pillow 35.9/100: 36% energy | 6.0/6: 100% combo_points temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6), finality_nightblade(5)
4:53.427 build G backstab Fluffy_Pillow 52.0/100: 52% energy | 0.0/6: 0% combo_points temptation(2), master_of_subtlety, symbols_of_death, finality_nightblade(5)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 8806 8481 0
Agility 32993 31287 20768 (10748)
Stamina 48391 48391 28183
Intellect 5325 5000 0
Spirit 0 0 0
Health 2903460 2903460 0
Energy 100 100 0
Combo Points 6 6 0
Crit 23.64% 23.64% 5456
Haste 9.55% 9.55% 3581
Damage / Heal Versatility 9.03% 8.23% 3909
Attack Power 32993 31287 0
Mastery 80.81% 80.81% 8510
Armor 2297 2297 2297
Run Speed 8 0 0

Gear

Source Slot Average Item Level: 891.00
Local Head Cowl of Fright
ilevel: 885, stats: { 300 Armor, +2829 Sta, +1886 AgiInt, +1015 Mastery, +547 Crit, +1076 unknown }
Local Neck Sea Fan Pendant
ilevel: 880, stats: { +1519 Sta, +1633 Vers, +965 Mastery }, enchant: mark_of_the_hidden_satyr
Local Shoulders Steelgazer Hide Mantle
ilevel: 880, stats: { 273 Armor, +1351 AgiInt, +2027 Sta, +673 Haste, +476 Vers, +771 unknown }
Local Shirt Common Gray Shirt
ilevel: 1
Local Chest Biornskin Vest
ilevel: 890, stats: { 376 Armor, +1977 AgiInt, +2965 Sta, +1034 Crit, +557 Mastery }
Local Waist Strand of Whelk Shells
ilevel: 880, stats: { 205 Armor, +2026 Sta, +1351 AgiInt, +673 Haste, +476 Mastery }, gems: { +150 Mastery }
Local Legs Legwraps of Unworthy Souls
ilevel: 880, stats: { 318 Armor, +2701 Sta, +1801 AgiInt, +964 Mastery, +570 Haste }
Local Feet Shadow Satyr's Walk
ilevel: 910, stats: { 276 Armor, +2680 Sta, +1786 Agi, +827 Haste, +459 Mastery }
Local Wrists Denial of the Half-Giants
ilevel: 910, stats: { 176 Armor, +2010 Sta, +1340 Agi, +276 Crit, +689 Mastery }
Local Hands Cruel Vice Grips
ilevel: 885, stats: { 231 Armor, +2122 Sta, +1415 AgiInt, +686 Crit, +485 Mastery }
Local Finger1 Grubby Silver Ring
ilevel: 880, stats: { +1519 Sta, +1484 Crit, +1114 Vers }, gems: { +150 Vers }, enchant: { +200 Mastery }
Local Finger2 Ring of Collapsing Futures
ilevel: 870, stats: { +1385 Sta, +1677 Mastery, +768 Haste, +419 Avoidance }, enchant: { +200 Vers }
Local Trinket1 Arcanogolem Digit
ilevel: 910, stats: { +2264 Agi }
Local Trinket2 Nightblooming Frond
ilevel: 910, stats: { +2264 Agi }
Local Back Drape of the Mana-Starved
ilevel: 875, stats: { 142 Armor, +1450 Sta, +967 StrAgiInt, +586 Crit, +259 Vers }, gems: { +200 Agi }, enchant: { +200 Agi }
Local Main Hand Fangs of the Devourer
ilevel: 906, weapon: { 3844 - 7140, 1.8 }, stats: { +983 Agi, +1475 Sta, +368 Crit, +353 Mastery }, relics: { +53 ilevels, +51 ilevels, +52 ilevels }
Local Off Hand Fangs of the Devourer
ilevel: 906, weapon: { 3844 - 7140, 1.8 }, stats: { +983 Agi, +1475 Sta, +368 Crit, +353 Mastery }

Talents

Level
15 Master of Subtlety (Subtlety Rogue) Weaponmaster (Subtlety Rogue) Gloomblade (Subtlety Rogue)
30 Nightstalker Subterfuge Shadow Focus
45 Deeper Stratagem Anticipation Vigor
60 Soothing Darkness (Subtlety Rogue) Elusiveness Cheat Death
75 Strike from the Shadows (Subtlety Rogue) Prey on the Weak Tangled Shadow (Subtlety Rogue)
90 Premeditation (Subtlety Rogue) Alacrity Enveloping Shadows (Subtlety Rogue)
100 Master of Shadows (Subtlety Rogue) Marked for Death Death from Above

Profile

rogue="AD+NF"
origin="https://eu.api.battle.net/wow/character/dalaran/Esdeåth/advanced"
level=110
race=human
role=attack
position=back
professions=alchemy=800/enchanting=133
talents=1210011
artifact=17:0:0:0:0:851:1:852:3:853:3:854:3:855:3:856:3:857:3:858:3:859:3:860:3:861:1:862:1:863:1:864:1:865:1:866:1:1349:1:1386:14
spec=subtlety

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,name=flask_of_the_seventh_demon
actions.precombat+=/augmentation,name=defiled
actions.precombat+=/food,name=seedbattered_fish_plate
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/stealth
actions.precombat+=/potion,name=old_war
actions.precombat+=/marked_for_death,if=raid_event.adds.in>40
# Defined variables that doesn't change during the fight
actions.precombat+=/variable,name=ssw_refund,value=equipped.shadow_satyrs_walk*(4+ssw_refund_offset)
actions.precombat+=/variable,name=stealth_threshold,value=(15+talent.vigor.enabled*35+talent.master_of_shadows.enabled*30+variable.ssw_refund)
actions.precombat+=/enveloping_shadows,if=combo_points>=5
actions.precombat+=/symbols_of_death

# Executed every time the actor is available.
actions=call_action_list,name=cds
# Fully switch to the Stealthed Rotation (by doing so, it forces pooling if nothing is available)
actions+=/run_action_list,name=stealthed,if=stealthed.all
actions+=/call_action_list,name=finish,if=combo_points>=5|(combo_points>=4&spell_targets.shuriken_storm>=3&spell_targets.shuriken_storm<=4)
actions+=/call_action_list,name=stealth_als,if=combo_points.deficit>=2+talent.premeditation.enabled
actions+=/call_action_list,name=build,if=energy.deficit<=variable.stealth_threshold

# Builders
actions.build=shuriken_storm,if=spell_targets.shuriken_storm>=2
actions.build+=/gloomblade
actions.build+=/backstab

# Cooldowns
actions.cds=potion,name=old_war,if=buff.bloodlust.react|target.time_to_die<=25|buff.shadow_blades.up
actions.cds+=/use_item,slot=finger2,if=(buff.shadow_blades.up&stealthed.rogue)|target.time_to_die<20
actions.cds+=/blood_fury,if=stealthed.rogue
actions.cds+=/berserking,if=stealthed.rogue
actions.cds+=/arcane_torrent,if=stealthed.rogue&energy.deficit>70
actions.cds+=/shadow_blades,if=combo_points<=2|(equipped.denial_of_the_halfgiants&combo_points>=1)
actions.cds+=/goremaws_bite,if=!stealthed.all&cooldown.shadow_dance.charges_fractional<=2.45&((combo_points.deficit>=4-(time<10)*2&energy.deficit>50+talent.vigor.enabled*25-(time>=10)*15)|target.time_to_die<8)
actions.cds+=/marked_for_death,target_if=min:target.time_to_die,if=target.time_to_die<combo_points.deficit|(raid_event.adds.in>40&combo_points.deficit>=4+talent.deeper_strategem.enabled+talent.anticipation.enabled)

# Finishers
actions.finish=enveloping_shadows,if=buff.enveloping_shadows.remains<target.time_to_die&buff.enveloping_shadows.remains<=combo_points*1.8
actions.finish+=/death_from_above,if=spell_targets.death_from_above>=6
actions.finish+=/nightblade,cycle_targets=1,if=target.time_to_die>8&((refreshable&(!finality|buff.finality_nightblade.up))|remains<tick_time)
actions.finish+=/death_from_above
actions.finish+=/eviscerate

# Stealth Action List Starter
actions.stealth_als=call_action_list,name=stealth_cds,if=energy.deficit<=variable.stealth_threshold&(!equipped.shadow_satyrs_walk|cooldown.shadow_dance.charges_fractional>=2.45|energy.deficit>=10)
actions.stealth_als+=/call_action_list,name=stealth_cds,if=spell_targets.shuriken_storm>=5
actions.stealth_als+=/call_action_list,name=stealth_cds,if=(cooldown.shadowmeld.up&!cooldown.vanish.up&cooldown.shadow_dance.charges<=1)
actions.stealth_als+=/call_action_list,name=stealth_cds,if=target.time_to_die<12*cooldown.shadow_dance.charges_fractional*(1+equipped.shadow_satyrs_walk*0.5)

# Stealth Cooldowns
actions.stealth_cds=shadow_dance,if=charges_fractional>=2.45
actions.stealth_cds+=/vanish
actions.stealth_cds+=/sprint_offensive
actions.stealth_cds+=/shadow_dance,if=charges>=2&combo_points<=1
actions.stealth_cds+=/pool_resource,for_next=1,extra_amount=40
actions.stealth_cds+=/shadowmeld,if=energy>=40&energy.deficit>=10+variable.ssw_refund
actions.stealth_cds+=/shadow_dance,if=combo_points<=1

# Stealthed Rotation
actions.stealthed=symbols_of_death,if=(buff.symbols_of_death.remains<target.time_to_die-4&buff.symbols_of_death.remains<=buff.symbols_of_death.duration*0.3)|equipped.shadow_satyrs_walk&energy.time_to_max<0.25
actions.stealthed+=/call_action_list,name=finish,if=combo_points>=5
actions.stealthed+=/shuriken_storm,if=buff.shadowmeld.down&((combo_points.deficit>=3&spell_targets.shuriken_storm>=2+talent.premeditation.enabled+equipped.shadow_satyrs_walk)|buff.the_dreadlords_deceit.stack>=29)
actions.stealthed+=/shadowstrike

head=cowl_of_fright,id=139205,bonus_id=1805/43/1507/3337
neck=sea_fan_pendant,id=142428,bonus_id=3507/1497,enchant=mark_of_the_hidden_satyr
shoulders=steelgazer_hide_mantle,id=134154,bonus_id=3417/43/1542/3337
back=drape_of_the_manastarved,id=141543,bonus_id=1808/1487/3337,gems=200agi,enchant=200agi
chest=biornskin_vest,id=134197,bonus_id=3417/1552/3337
shirt=common_gray_shirt,id=3428
wrists=denial_of_the_halfgiants,id=137100,bonus_id=3459/3458
hands=cruel_vice_grips,id=133617,bonus_id=3510/1537/3337
waist=strand_of_whelk_shells,id=142416,bonus_id=3507/1808/1497,gems=150mastery
legs=legwraps_of_unworthy_souls,id=133616,bonus_id=3418/1532/3337
feet=shadow_satyrs_walk,id=137032,bonus_id=3459/3458
finger1=grubby_silver_ring,id=139236,bonus_id=1806/1808/1502,gems=150vers,enchant=200mastery
finger2=ring_of_collapsing_futures,id=142173,bonus_id=40/3453/1482/3336,enchant=200vers
trinket1=arcanogolem_digit,id=140794,bonus_id=3519
trinket2=nightblooming_frond,id=140802,bonus_id=3519
main_hand=fangs_of_the_devourer,id=128476,bonus_id=743,gem_id=139267/142512/139253/0,relic_id=1806:1507:3336/3468:1492/1806:1502/0
off_hand=fangs_of_the_devourer,id=128479

# Gear Summary
# gear_ilvl=891.06
# gear_agility=20768
# gear_stamina=28183
# gear_crit_rating=5349
# gear_haste_rating=3511
# gear_mastery_rating=8343
# gear_versatility_rating=3832
# gear_avoidance_rating=419
# gear_armor=2297

CoF+AD : 594862 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
594861.7 594861.7 609.6 / 0.102% 85844.0 / 14.4% 19718.8
RPS Out RPS In Primary Resource Waiting APM Active Skill
30.1 30.1 Energy 20.11% 59.3 100.0% 100%
Origin https://eu.api.battle.net/wow/character/dalaran/Esdeåth/advanced
Talents
  • 15: Master of Subtlety (Subtlety Rogue)
  • 30: Subterfuge
  • 45: Deeper Stratagem
  • 90: Premeditation (Subtlety Rogue)
  • 100: Master of Shadows (Subtlety Rogue)
  • Talent Calculator
Artifact
Professions
  • alchemy: 800
  • enchanting: 133

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
CoF+AD 594862
Arcane Swipe 10443 1.8% 32.7 9.26sec 95933 0 Direct 32.7 77491 154976 95932 23.8% 0.0%  

Stats details: arcane_swipe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 32.75 32.75 0.00 0.00 0.0000 0.0000 3141612.31 3141612.31 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 24.95 76.20% 77490.77 59397 78404 77496.60 75285 78404 1933704 1933704 0.00
crit 7.79 23.80% 154976.14 118793 156807 154944.24 0 156807 1207909 1207909 0.00
 
 

Action details: arcane_swipe

Static Values
  • id:225721
  • school:arcane
  • resource:none
  • range:12.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:225721
  • name:Arcane Swipe
  • school:arcane
  • tooltip:
  • description:{$@spelldesc225127=Your melee attacks have a chance to rake all enemies in front of you for {$225721s1=18328} Arcane damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:48856.63
  • base_dd_max:48856.63
 
auto_attack_mh 6944 1.2% 80.2 2.94sec 26206 16781 Direct 80.2 25043 50085 26206 23.7% 19.0%  

Stats details: auto_attack_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 80.20 80.20 0.00 0.00 1.5616 0.0000 2101565.69 3089500.63 31.98 16781.11 16781.11
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 45.98 57.33% 25042.60 19317 25498 25045.29 24199 25498 1151401 1692669 31.98
crit 18.97 23.66% 50084.52 38633 50996 50087.41 47596 50996 950165 1396832 31.98
miss 15.25 19.01% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_mh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
auto_attack_oh 3455 0.6% 79.8 2.95sec 13106 8348 Direct 79.8 12520 25044 13105 23.7% 19.0%  

Stats details: auto_attack_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 79.79 79.79 0.00 0.00 1.5699 0.0000 1045654.04 1537210.49 31.98 8348.34 8348.34
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 45.68 57.25% 12520.16 9658 12749 12521.72 12017 12749 571898 840744 31.98
crit 18.92 23.71% 25043.79 19317 25498 25046.92 23824 25498 473756 696466 31.98
miss 15.19 19.04% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_oh

Static Values
  • id:1
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Backstab 26808 4.5% 47.5 6.05sec 170398 169635 Direct 47.5 137929 275833 170392 23.5% 0.0%  

Stats details: backstab

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.52 47.52 0.00 0.00 1.0045 0.0000 8097378.16 11903912.90 31.98 169635.44 169635.44
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 36.33 76.46% 137928.67 106732 140886 137937.86 133581 140886 5011181 7366910 31.98
crit 11.19 23.54% 275833.37 213463 281772 275853.32 256156 281772 3086197 4537003 31.98
 
 

Action details: backstab

Static Values
  • id:53
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:53
  • name:Backstab
  • school:physical
  • tooltip:
  • description:Stab the target, causing ${$sw2*$<mult>} Physical damage. Damage increased by {$s4=30}% when you are behind your target. |cFFFFFFFFAwards {$s3=1} combo $lpoint:points;.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.70
 
Collapse 1854 0.3% 6.7 29.69sec 82375 0 Direct 6.7 66627 133258 82371 23.6% 0.0%  

Stats details: collapse

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.70 6.70 0.00 0.00 0.0000 0.0000 552270.29 552270.29 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.12 76.37% 66627.32 50574 66758 66194.46 0 66758 341121 341121 0.00
crit 1.58 23.63% 133258.00 101148 133516 100645.85 0 133516 211149 211149 0.00
 
 

Action details: collapse

Static Values
  • id:234142
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:15.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:234142
  • name:Collapse
  • school:shadow
  • tooltip:
  • description:Deal {$s1=40000} Shadow damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:40000.00
  • base_dd_max:40000.00
 
Eviscerate 193346 32.5% 59.1 5.06sec 983818 979425 Direct 59.1 709663 1418614 983842 38.7% 0.0%  

Stats details: eviscerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 59.07 59.07 0.00 0.00 1.0045 0.0000 58111220.09 85428997.98 31.98 979424.60 979424.60
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 36.22 61.33% 709662.68 432169 848849 709852.38 660319 758261 25707419 37792341 31.98
crit 22.84 38.67% 1418614.11 864338 1697697 1418931.00 1282966 1551382 32403801 47636657 31.98
 
 

Action details: eviscerate

Static Values
  • id:196819
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.15
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:196819
  • name:Eviscerate
  • school:physical
  • tooltip:
  • description:Finishing move that disembowels the target, causing damage per combo point. 1 point : ${$m1*1} damage 2 points: ${$m1*2} damage 3 points: ${$m1*3} damage 4 points: ${$m1*4} damage 5 points: ${$m1*5} damage{$?s193531=false}[ 6 points: ${$m1*6} damage][]
Weapon
  • normalized:false
  • weapon_power_mod:0.000000
  • weapon_multiplier:0.00
 
Goremaw's Bite 0 (9946) 0.0% (1.7%) 4.6 64.08sec 647277 644454

Stats details: goremaws_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.63 0.00 0.00 0.00 1.0045 0.0000 0.00 0.00 0.00 644453.77 644453.77
 
 

Action details: goremaws_bite

Static Values
  • id:209782
  • school:shadow
  • resource:none
  • range:8.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!stealthed.all&cooldown.shadow_dance.charges_fractional<=2.45&((combo_points.deficit>=4-(time<10)*2&energy.deficit>50+talent.vigor.enabled*25-(time>=10)*15)|target.time_to_die<8)
Spelldata
  • id:209782
  • name:Goremaw's Bite
  • school:physical
  • tooltip:
  • description:Lashes out at the target, inflicting ${$209783sw2+$209784sw2} Shadow damage and reducing movement speed by {$209786s1=60}% for {$209786d=8 seconds}. Grants $220901o2 Energy over {$220901d=6 seconds}. |cFFFFFFFFAwards {$220901s1=3} combo $lpoint:points;.|r
 
    Goremaw's Bite (_mh) 6628 1.1% 4.6 64.08sec 431285 0 Direct 4.6 349453 699387 431278 23.4% 0.0%  

Stats details: goremaws_bite_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.63 4.63 0.00 0.00 0.0000 0.0000 1996298.22 1996298.22 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 3.55 76.62% 349453.07 272066 359127 348610.13 0 359127 1239285 1239285 0.00
crit 1.08 23.38% 699386.95 544132 718254 489631.20 0 718254 757013 757013 0.00
 
 

Action details: goremaws_bite_mh

Static Values
  • id:209783
  • school:shadow
  • resource:none
  • range:8.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:209783
  • name:Goremaw's Bite
  • school:shadow
  • tooltip:
  • description:{$@spelldesc209782=Lashes out at the target, inflicting ${$209783sw2+$209784sw2} Shadow damage and reducing movement speed by {$209786s1=60}% for {$209786d=8 seconds}. Grants $220901o2 Energy over {$220901d=6 seconds}. |cFFFFFFFFAwards {$220901s1=3} combo $lpoint:points;.|r}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:10.00
 
    Goremaw's Bite (_oh) 3318 0.6% 4.6 64.08sec 215992 0 Direct 4.6 174737 349690 215994 23.6% 0.0%  

Stats details: goremaws_bite_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.63 4.63 0.00 0.00 0.0000 0.0000 999767.34 999767.34 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 3.54 76.42% 174737.46 136039 179572 174574.80 0 179572 618100 618100 0.00
crit 1.09 23.58% 349689.55 272079 359144 248495.40 0 359144 381668 381668 0.00
 
 

Action details: goremaws_bite_oh

Static Values
  • id:209784
  • school:shadow
  • resource:none
  • range:8.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:209784
  • name:Goremaw's Bite
  • school:shadow
  • tooltip:
  • description:{$@spelldesc209782=Lashes out at the target, inflicting ${$209783sw2+$209784sw2} Shadow damage and reducing movement speed by {$209786s1=60}% for {$209786d=8 seconds}. Grants $220901o2 Energy over {$220901d=6 seconds}. |cFFFFFFFFAwards {$220901s1=3} combo $lpoint:points;.|r}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:10.00
 
Mark of the Hidden Satyr 8795 1.5% 16.4 18.20sec 161516 0 Direct 16.4 130784 261510 161525 23.5% 0.0%  

Stats details: mark_of_the_hidden_satyr

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.38 16.38 0.00 0.00 0.0000 0.0000 2645328.46 2645328.46 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 12.53 76.49% 130783.51 100276 132364 130797.11 124651 132364 1638413 1638413 0.00
crit 3.85 23.51% 261510.21 200552 264729 256354.37 0 264729 1006916 1006916 0.00
 
 

Action details: mark_of_the_hidden_satyr

Static Values
  • id:191259
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191259
  • name:Mark of the Hidden Satyr
  • school:fire
  • tooltip:
  • description:Deals fire damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:2.500000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Nightblade 120752 20.3% 17.0 17.54sec 2135270 2125764 Periodic 145.6 201969 403797 249777 23.7% 0.0% 96.7%

Stats details: nightblade

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.04 0.00 145.65 145.65 1.0045 2.0000 36380324.83 36380324.83 0.00 117959.76 2125763.98
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 111.1 76.31% 201968.53 137013 224267 201986.58 196566 207207 22448144 22448144 0.00
crit 34.5 23.69% 403796.95 274025 448534 403816.62 377238 432823 13932180 13932180 0.00
 
 

Action details: nightblade

Static Values
  • id:195452
  • school:shadow
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:25.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:target.time_to_die>8&((refreshable&(!finality|buff.finality_nightblade.up))|remains<tick_time)
Spelldata
  • id:195452
  • name:Nightblade
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec and snared by attacks.
  • description:Finishing move that infects the target with shadowy energy, dealing Shadow damage over time and causing attacks against the target to reduce movement speed by {$206760s1=30}% for {$206760d=8 seconds}. Lasts longer per combo point. 1 point : ${$m1*8/2} over 8 sec 2 points: ${$m1*10/2} over 10 sec 3 points: ${$m1*12/2} over 12 sec 4 points: ${$m1*14/2} over 14 sec 5 points: ${$m1*16/2} over 16 sec{$?s193531=false}[ 6 points: ${$m1*18/2} over 18 sec][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:1.380000
  • spell_power_mod.tick:0.000000
  • base_td:1.00
  • dot_duration:6.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Potion of the Old War 18600 3.1% 23.2 5.09sec 237064 0 Direct 23.2 191839 383706 237073 23.6% 0.0%  

Stats details: potion_of_the_old_war

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.19 23.19 0.00 0.00 0.0000 0.0000 5497048.93 8081182.62 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.72 76.43% 191839.16 146122 192882 191838.73 183653 192882 3399833 4998077 31.98
crit 5.47 23.57% 383706.13 292245 385763 382476.34 0 385763 2097216 3083106 31.87
 
 

Action details: potion_of_the_old_war

Static Values
  • id:188028
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188028
  • name:Potion of the Old War
  • school:physical
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:135920.00
  • base_dd_max:203880.00
 
Shadow Blades 0 (24084) 0.0% (4.0%) 3.6 98.21sec 2034472 0

Stats details: shadow_blades

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.55 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: shadow_blades

Static Values
  • id:121471
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:combo_points<=2|(equipped.denial_of_the_halfgiants&combo_points>=1)
Spelldata
  • id:121471
  • name:Shadow Blades
  • school:physical
  • tooltip:Autoattacks deal pure Shadow damage. Combo-point-generating attacks generate {$s2=1} additional combo point.
  • description:Draws upon surrounding shadows to empower your weapons, causing auto attacks to deal Shadow damage and abilities that generate combo points to generate 1 additional combo point. Lasts {$d=15 seconds}.
 
    Shadow Blade (_mh) 16059 2.7% 104.8 2.73sec 45962 30683 Direct 104.8 37149 74301 45962 23.7% 0.0%  

Stats details: shadow_blade_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 104.81 104.81 0.00 0.00 1.4980 0.0000 4817134.63 4817134.63 0.00 30682.97 30682.97
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 79.95 76.28% 37149.11 28397 37484 37149.60 36125 37484 2969932 2969932 0.00
crit 24.86 23.72% 74301.30 56794 74969 74302.01 71871 74969 1847202 1847202 0.00
 
 

Action details: shadow_blade_mh

Static Values
  • id:121473
  • school:shadow
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:121473
  • name:Shadow Blade
  • school:shadow
  • tooltip:
  • description:Strike with dark energy, dealing Shadow damage equal to {$s1=1}% weapon damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
    Shadow Blade Off-hand 8025 1.3% 104.8 2.73sec 22967 15332 Direct 104.8 18574 37153 22967 23.6% 0.0%  

Stats details: shadow_blade_offhand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 104.81 104.81 0.00 0.00 1.4980 0.0000 2407091.56 2407091.56 0.00 15332.28 15332.28
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 80.03 76.36% 18574.16 14199 18742 18574.40 18241 18742 1486410 1486410 0.00
crit 24.78 23.64% 37153.40 28397 37484 37153.10 35922 37484 920682 920682 0.00
 
 

Action details: shadow_blade_offhand

Static Values
  • id:121474
  • school:shadow
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:121474
  • name:Shadow Blade Off-hand
  • school:shadow
  • tooltip:
  • description:Strike with dark energy, dealing Shadow damage equal to {$s1=1}% weapon damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Shadow Nova 11426 1.9% 33.7 9.14sec 102045 0 Direct 33.7 82592 165182 102046 23.6% 0.0%  

Stats details: shadow_nova

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 33.66 33.66 0.00 0.00 0.0000 0.0000 3434329.31 3434329.31 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 25.73 76.45% 82591.66 68830 82595 82591.76 81831 82595 2124930 2124930 0.00
crit 7.93 23.55% 165182.48 137659 165191 165150.32 0 165191 1309399 1309399 0.00
 
 

Action details: shadow_nova

Static Values
  • id:197800
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:5.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:197800
  • name:Shadow Nova
  • school:shadow
  • tooltip:
  • description:Deals {$s1=0} Shadow damage to enemies with $A1 yards.
 
Shadowstrike 128552 (158408) 21.6% (26.6%) 111.3 2.71sec 427492 425580 Direct 111.3 260257 520525 346898 33.3% 0.0%  

Stats details: shadowstrike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 111.33 111.33 0.00 0.00 1.0045 0.0000 38620503.65 56775798.60 31.98 425579.69 425579.69
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 74.27 66.71% 260257.33 216893 260271 260258.25 257827 260271 19328596 28414867 31.98
crit 37.06 33.29% 520524.89 433785 520542 520524.60 516411 520542 19291908 28360932 31.98
 
 

Action details: shadowstrike

Static Values
  • id:185438
  • school:physical
  • resource:energy
  • range:15.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:185438
  • name:Shadowstrike
  • school:physical
  • tooltip:
  • description:Strike through the shadows, $?a231718[appearing behind your target and ][]dealing $sw2 Physical damage. |cFFFFFFFFAwards {$s3=1} combo $lpoint:points;.|r
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:8.50
 
    Soul Rip 29856 5.0% 110.7 2.69sec 81059 0 Direct 110.7 65553 131106 81060 23.7% 0.0%  

Stats details: soul_rip

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 110.69 110.69 0.00 0.00 0.0000 0.0000 8972072.72 8972072.72 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 84.50 76.35% 65553.23 65553 65553 65553.23 65553 65553 5539465 5539465 0.00
crit 26.18 23.65% 131106.47 131106 131106 131106.47 131106 131106 3432608 3432608 0.00
 
 

Action details: soul_rip

Static Values
  • id:220893
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:220893
  • name:Soul Rip
  • school:shadow
  • tooltip:
  • description:{$@spelldesc209835=After using Shadowstrike or Cheap Shot, Akaari's Soul appears $m1 sec later and Soul Rips your target, dealing {$220893s1=1} Shadow damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:1.500000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Simple Action Stats Execute Interval
CoF+AD
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:CoF+AD
  • harmful:false
  • if_expr:
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:CoF+AD
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:CoF+AD
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Shadow Dance 28.2 10.72sec

Stats details: shadow_dance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 28.17 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: shadow_dance

Static Values
  • id:185313
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:charges_fractional>=2.45
Spelldata
  • id:185313
  • name:Shadow Dance
  • school:physical
  • tooltip:
  • description:Allows use of all Stealth abilities and grants all the combat benefits of Stealth for {$d=3 seconds}. Effect not broken from taking damage or attacking. {$?s14062=false}[Movement speed while active is increased by {$1784s3=0}% and damage dealt is increased by {$1784s4=0}%. ]?s108209[Abilities cost {$112942s1=75}% less while active. ][]{$?s31223=false}[Attacks from Shadow Dance and for {$31223s1=5} sec after deal {$31665s1=10}% more damage. ][]
 
Sprint 2.7 122.50sec

Stats details: sprint

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.74 0.00 86.72 0.00 0.0000 0.2500 0.00 0.00 0.00 0.00 0.00
 
 

Action details: sprint

Static Values
  • id:2983
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:2983
  • name:Sprint
  • school:physical
  • tooltip:Movement speed increased by $w1%.
  • description:Increases your movement speed by {$s1=70}% for {$d=8 seconds}. Usable while stealthed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:0.25
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Symbols of Death 14.1 22.31sec

Stats details: symbols_of_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.11 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: symbols_of_death

Static Values
  • id:212283
  • school:physical
  • resource:energy
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:10.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:212283
  • name:Symbols of Death
  • school:physical
  • tooltip:All damage done increased by {$s1=20}%.
  • description:Invoke ancient symbols of power, increasing all damage you deal by {$s1=20}% for {$d=35 seconds}, and causing your next Shadowstrike to critically strike. Unaffected by the global cooldown.
 
Vanish 2.8 122.48sec

Stats details: vanish

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.85 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: vanish

Static Values
  • id:1856
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:1856
  • name:Vanish
  • school:physical
  • tooltip:Improved stealth.
  • description:Allows you to vanish from sight, entering stealth while in combat. For the first {$11327d=3 seconds} after vanishing, damage and harmful effects received will not break stealth. Also breaks movement impairing effects.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 37.57% 0.0(0.0) 1.0

Buff details

  • buff initial source:CoF+AD
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Death 14.1 0.0 21.5sec 22.4sec 1.35% 12.54% 0.0(0.0) 0.2

Buff details

  • buff initial source:CoF+AD
  • cooldown name:buff_death
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • death_1:1.35%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:227151
  • name:Death
  • tooltip:Your next Shadowstrike will critically strike.
  • description:{$@spelldesc212283=Invoke ancient symbols of power, increasing all damage you deal by {$s1=20}% for {$d=35 seconds}, and causing your next Shadowstrike to critically strike. Unaffected by the global cooldown.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Faster Than Light Trigger 2.7 0.0 122.5sec 122.5sec 2.72% 2.72% 0.0(0.0) 2.7

Buff details

  • buff initial source:CoF+AD
  • cooldown name:buff_faster_than_light_trigger
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • faster_than_light_trigger_1:2.72%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:197270
  • name:Faster Than Light Trigger
  • tooltip:
  • description:
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
Finality: Eviscerate 29.8 0.0 10.1sec 10.1sec 48.96% 49.56% 0.0(0.0) 0.0

Buff details

  • buff initial source:CoF+AD
  • cooldown name:buff_finality_eviscerate
  • max_stacks:10
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.04

Stack Uptimes

  • finality_eviscerate_5:18.41%
  • finality_eviscerate_6:30.55%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:197496
  • name:Finality: Eviscerate
  • tooltip:Your next Eviscerate will do $w1% increased damage.
  • description:
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Finality: Nightblade 8.7 0.0 35.3sec 35.3sec 42.77% 40.48% 0.0(0.0) 0.0

Buff details

  • buff initial source:CoF+AD
  • cooldown name:buff_finality_nightblade
  • max_stacks:6
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.04

Stack Uptimes

  • finality_nightblade_5:13.80%
  • finality_nightblade_6:28.97%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:197498
  • name:Finality: Nightblade
  • tooltip:Your next Nightblade will do $w1% increased damage.
  • description:
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Goremaw's Bite 4.6 0.0 64.0sec 64.0sec 9.12% 9.12% 27.4(27.4) 4.5

Buff details

  • buff initial source:CoF+AD
  • cooldown name:buff_goremaws_bite
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • goremaws_bite_1:9.12%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:220901
  • name:Goremaw's Bite
  • tooltip:Generating {$s2=5} Energy every $t2 sec.
  • description:{$@spelldesc209782=Lashes out at the target, inflicting ${$209783sw2+$209784sw2} Shadow damage and reducing movement speed by {$209786s1=60}% for {$209786d=8 seconds}. Grants $220901o2 Energy over {$220901d=6 seconds}. |cFFFFFFFFAwards {$220901s1=3} combo $lpoint:points;.|r}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Master of Subtlety 38.6 1.6 7.9sec 7.5sec 34.89% 47.47% 1.6(1.6) 12.0

Buff details

  • buff initial source:CoF+AD
  • cooldown name:buff_master_of_subtlety
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • master_of_subtlety_1:34.89%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:31223
  • name:Master of Subtlety
  • tooltip:
  • description:Attacks made while stealthed and for {$s1=5} seconds after breaking stealth cause an additional {$31665s1=10}% damage.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Master of Subtlety (_aura) 38.6 1.7 7.9sec 7.6sec 51.30% 36.83% 1.7(1.7) 0.0

Buff details

  • buff initial source:CoF+AD
  • cooldown name:buff_master_of_subtlety_aura
  • max_stacks:1
  • duration:150.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • master_of_subtlety_aura_1:51.30%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:31223
  • name:Master of Subtlety
  • tooltip:
  • description:Attacks made while stealthed and for {$s1=5} seconds after breaking stealth cause an additional {$31665s1=10}% damage.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of the Old War 2.0 0.0 87.2sec 0.0sec 16.24% 16.24% 0.0(0.0) 2.0

Buff details

  • buff initial source:CoF+AD
  • cooldown name:buff_potion_of_the_old_war
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_the_old_war_1:16.24%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188028
  • name:Potion of the Old War
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Shadow Blades 3.6 0.0 97.4sec 98.1sec 55.92% 60.47% 0.0(0.0) 3.2

Buff details

  • buff initial source:CoF+AD
  • cooldown name:buff_shadow_blades
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • shadow_blades_1:55.92%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:121471
  • name:Shadow Blades
  • tooltip:Autoattacks deal pure Shadow damage. Combo-point-generating attacks generate {$s2=1} additional combo point.
  • description:Draws upon surrounding shadows to empower your weapons, causing auto attacks to deal Shadow damage and abilities that generate combo points to generate 1 additional combo point. Lasts {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Shadow Dance 28.2 0.0 10.7sec 10.7sec 46.52% 46.52% 0.0(0.0) 27.8

Buff details

  • buff initial source:CoF+AD
  • cooldown name:buff_shadow_dance
  • max_stacks:1
  • duration:5.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • shadow_dance_1:46.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:185313
  • name:Shadow Dance
  • tooltip:
  • description:Allows use of all Stealth abilities and grants all the combat benefits of Stealth for {$d=3 seconds}. Effect not broken from taking damage or attacking. {$?s14062=false}[Movement speed while active is increased by {$1784s3=0}% and damage dealt is increased by {$1784s4=0}%. ]?s108209[Abilities cost {$112942s1=75}% less while active. ][]{$?s31223=false}[Attacks from Shadow Dance and for {$31223s1=5} sec after deal {$31665s1=10}% more damage. ][]
  • max_stacks:0
  • duration:3.00
  • cooldown:1.00
  • default_chance:0.00%
Sprint 2.7 0.0 122.5sec 122.5sec 7.20% 7.20% 86.7(86.7) 2.7

Buff details

  • buff initial source:CoF+AD
  • cooldown name:buff_sprint
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • sprint_1:7.20%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2983
  • name:Sprint
  • tooltip:Movement speed increased by $w1%.
  • description:Increases your movement speed by {$s1=70}% for {$d=8 seconds}. Usable while stealthed.
  • max_stacks:0
  • duration:8.00
  • cooldown:120.00
  • default_chance:0.00%
Stealth 6.5 0.0 45.0sec 52.2sec 1.02% 1.02% 0.0(0.0) 0.0

Buff details

  • buff initial source:CoF+AD
  • cooldown name:buff_stealth
  • max_stacks:1
  • duration:150.00
  • cooldown:2.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stealth_1:1.02%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:1784
  • name:Stealth
  • tooltip:Stealthed.$?$w3!=0[ Movement speed increased by $w3%.][]$?$w4!=0[ Damage increased by $w4%.][]
  • description:Conceals you in the shadows until cancelled, allowing you to stalk enemies without being seen. {$?s14062=false}[Movement speed while stealthed is increased by {$s3=0}% and damage dealt is increased by {$s4=0}%.]?s108209[ Abilities cost {$112942s1=75}% less while stealthed. ][]{$?s31223=false}[ Attacks from Stealth and for {$31223s1=5} sec after deal {$31665s1=10}% more damage.][]
  • max_stacks:0
  • duration:-0.00
  • cooldown:2.00
  • default_chance:100.00%
Subterfuge 6.6 0.0 44.7sec 52.3sec 6.54% 6.54% 0.0(0.0) 6.5

Buff details

  • buff initial source:CoF+AD
  • cooldown name:buff_subterfuge
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • subterfuge_1:6.54%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:115192
  • name:Subterfuge
  • tooltip:Temporarily concealed in the shadows.
  • description:{$@spelldesc108208=Your abilities requiring Stealth can still be used for {$115192d=3 seconds} after Stealth breaks.$?c3[ Also increases the duration of Shadow Dance by ${$m2/1000} sec.][ Also causes Garrote to deal {$115192s2=125}% increased damage and have no cooldown when used from Stealth or {$115192d=3 seconds} after Stealth breaks.]}
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
Symbols of Death 1.1 13.0 191.5sec 22.4sec 99.87% 99.43% 13.0(13.0) 0.2

Buff details

  • buff initial source:CoF+AD
  • cooldown name:buff_symbols_of_death
  • max_stacks:1
  • duration:35.00
  • cooldown:10.00
  • default_chance:100.00%
  • default_value:1.20

Stack Uptimes

  • symbols_of_death_1:99.87%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:212283
  • name:Symbols of Death
  • tooltip:All damage done increased by {$s1=20}%.
  • description:Invoke ancient symbols of power, increasing all damage you deal by {$s1=20}% for {$d=35 seconds}, and causing your next Shadowstrike to critically strike. Unaffected by the global cooldown.
  • max_stacks:0
  • duration:35.00
  • cooldown:10.00
  • default_chance:0.00%
Temptation 2.1 4.6 117.3sec 30.1sec 43.47% 67.85% 0.0(0.0) 1.7

Buff details

  • buff initial source:CoF+AD
  • cooldown name:buff_temptation
  • max_stacks:10
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • temptation_1:10.89%
  • temptation_2:11.52%
  • temptation_3:12.13%
  • temptation_4:8.62%
  • temptation_5:0.24%
  • temptation_6:0.04%
  • temptation_7:0.03%
  • temptation_8:0.05%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:234143
  • name:Temptation
  • tooltip:Increased chance for your Ring of Collapsing Futures to incur a {$s1=5} min cooldown.
  • description:{$@spelldesc234142=Deal {$s1=40000} Shadow damage to an enemy.}
  • max_stacks:10
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Vanish 5.6 0.0 52.1sec 52.1sec 5.53% 5.53% 0.0(0.0) 5.5

Buff details

  • buff initial source:CoF+AD
  • cooldown name:buff_vanish
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • vanish_1:5.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:11327
  • name:Vanish
  • tooltip:Improved stealth.$?$w3!=0[ Movement speed increased by $w3%.][]$?$w4!=0[ Damage increased by $w4%.][]
  • description:
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:CoF+AD
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Seventh Demon

Buff details

  • buff initial source:CoF+AD
  • cooldown name:buff_flask_of_the_seventh_demon
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:1300.00

Stack Uptimes

  • flask_of_the_seventh_demon_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188033
  • name:Flask of the Seventh Demon
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (seedbattered_fish_plate)

Buff details

  • buff initial source:CoF+AD
  • cooldown name:buff_seedbattered_fish_plate
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:versatility_rating
  • amount:375.00

Stack Uptimes

  • seedbattered_fish_plate_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225605
  • name:Well Fed
  • tooltip:Versatility increased by $w1.
  • description:Increases versatility by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
CoF+AD
backstab Energy 47.5 1663.1 35.0 35.0 4868.7
eviscerate Energy 59.1 2067.3 35.0 35.0 28109.1
eviscerate Combo Points 59.1 334.0 5.7 5.7 173964.9
nightblade Energy 17.0 425.9 25.0 25.0 85412.0
nightblade Combo Points 17.0 96.4 5.7 5.7 377425.4
shadowstrike Energy 111.3 4453.2 40.0 40.0 10687.2
symbols_of_death Energy 14.1 458.8 32.5 32.5 0.0
Resource Gains Type Count Total Average Overflow
backstab Combo Points 47.52 47.52 (10.97%) 1.00 0.00 0.00%
goremaws_bite Combo Points 4.63 13.68 (3.16%) 2.96 0.20 1.46%
shadowstrike Combo Points 111.33 222.66 (51.38%) 2.00 0.00 0.00%
energy_regen Energy 1107.75 3322.15 (36.87%) 3.00 108.56 3.16%
Shadow Techniques Combo Points 74.97 70.17 (16.19%) 0.94 19.77 21.99%
Master of Shadows Energy 39.28 805.95 (8.94%) 20.52 175.97 17.92%
Shadow Blades Combo Points 93.38 79.30 (18.30%) 0.85 14.08 15.08%
Energetic Stabbing Energy 27.85 696.17 (7.73%) 25.00 0.00 0.00%
Goremaw's Bite Energy 27.42 132.91 (1.48%) 4.85 4.21 3.07%
Relentless Strikes Energy 76.10 3384.99 (37.57%) 44.48 58.50 1.70%
Shadow Satyr's Walk Energy 111.33 667.98 (7.41%) 6.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Energy 29.91 30.10
Combo Points 1.44 1.43
Combat End Resource Mean Min Max
Energy 41.25 6.03 100.00
Combo Points 2.99 0.00 6.00

Benefits & Uptimes

Benefits %
Uptimes %
Energy Cap 1.8%

Statistics & Data Analysis

Fight Length
Sample Data CoF+AD Fight Length
Count 4999
Mean 301.28
Minimum 222.03
Maximum 381.32
Spread ( max - min ) 159.29
Range [ ( max - min ) / 2 * 100% ] 26.44%
DPS
Sample Data CoF+AD Damage Per Second
Count 4999
Mean 594861.65
Minimum 511718.66
Maximum 682895.62
Spread ( max - min ) 171176.96
Range [ ( max - min ) / 2 * 100% ] 14.39%
Standard Deviation 21992.2686
5th Percentile 560159.16
95th Percentile 632042.76
( 95th Percentile - 5th Percentile ) 71883.59
Mean Distribution
Standard Deviation 311.0488
95.00% Confidence Intervall ( 594252.01 - 595471.30 )
Normalized 95.00% Confidence Intervall ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 53
0.1% Error 5251
0.1 Scale Factor Error with Delta=300 4128799
0.05 Scale Factor Error with Delta=300 16515196
0.01 Scale Factor Error with Delta=300 412879891
Priority Target DPS
Sample Data CoF+AD Priority Target Damage Per Second
Count 4999
Mean 594861.65
Minimum 511718.66
Maximum 682895.62
Spread ( max - min ) 171176.96
Range [ ( max - min ) / 2 * 100% ] 14.39%
Standard Deviation 21992.2686
5th Percentile 560159.16
95th Percentile 632042.76
( 95th Percentile - 5th Percentile ) 71883.59
Mean Distribution
Standard Deviation 311.0488
95.00% Confidence Intervall ( 594252.01 - 595471.30 )
Normalized 95.00% Confidence Intervall ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 53
0.1% Error 5251
0.1 Scale Factor Error with Delta=300 4128799
0.05 Scale Factor Error with Delta=300 16515196
0.01 Scale Factor Error with Delta=300 412879891
DPS(e)
Sample Data CoF+AD Damage Per Second (Effective)
Count 4999
Mean 594861.65
Minimum 511718.66
Maximum 682895.62
Spread ( max - min ) 171176.96
Range [ ( max - min ) / 2 * 100% ] 14.39%
Damage
Sample Data CoF+AD Damage
Count 4999
Mean 178819600.21
Minimum 129791708.61
Maximum 228326513.00
Spread ( max - min ) 98534804.40
Range [ ( max - min ) / 2 * 100% ] 27.55%
DTPS
Sample Data CoF+AD Damage Taken Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data CoF+AD Healing Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data CoF+AD Healing Per Second (Effective)
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data CoF+AD Heal
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data CoF+AD Healing Taken Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data CoF+AD Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data CoF+ADTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data CoF+AD Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,name=flask_of_the_seventh_demon
1 0.00 augmentation,name=defiled
2 0.00 food,name=seedbattered_fish_plate
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 stealth
5 0.00 potion,name=old_war
6 0.00 marked_for_death,if=raid_event.adds.in>40
7 0.00 variable,name=ssw_refund,value=equipped.shadow_satyrs_walk*(4+ssw_refund_offset)
Defined variables that doesn't change during the fight
8 0.00 variable,name=stealth_threshold,value=(15+talent.vigor.enabled*35+talent.master_of_shadows.enabled*30+variable.ssw_refund)
9 0.00 enveloping_shadows,if=combo_points>=5
A 0.00 symbols_of_death
Default action list Executed every time the actor is available.
# count action,conditions
B 0.00 call_action_list,name=cds
C 0.00 run_action_list,name=stealthed,if=stealthed.all
Fully switch to the Stealthed Rotation (by doing so, it forces pooling if nothing is available)
D 0.00 call_action_list,name=finish,if=combo_points>=5|(combo_points>=4&spell_targets.shuriken_storm>=3&spell_targets.shuriken_storm<=4)
E 0.00 call_action_list,name=stealth_als,if=combo_points.deficit>=2+talent.premeditation.enabled
F 0.00 call_action_list,name=build,if=energy.deficit<=variable.stealth_threshold
actions.build Builders
# count action,conditions
0.00 shuriken_storm,if=spell_targets.shuriken_storm>=2
0.00 gloomblade
G 47.52 backstab
actions.cds Cooldowns
# count action,conditions
H 1.00 potion,name=old_war,if=buff.bloodlust.react|target.time_to_die<=25|buff.shadow_blades.up
I 6.70 use_item,slot=finger2,if=(buff.shadow_blades.up&stealthed.rogue)|target.time_to_die<20
0.00 blood_fury,if=stealthed.rogue
0.00 berserking,if=stealthed.rogue
0.00 arcane_torrent,if=stealthed.rogue&energy.deficit>70
J 3.55 shadow_blades,if=combo_points<=2|(equipped.denial_of_the_halfgiants&combo_points>=1)
K 4.63 goremaws_bite,if=!stealthed.all&cooldown.shadow_dance.charges_fractional<=2.45&((combo_points.deficit>=4-(time<10)*2&energy.deficit>50+talent.vigor.enabled*25-(time>=10)*15)|target.time_to_die<8)
0.00 marked_for_death,target_if=min:target.time_to_die,if=target.time_to_die<combo_points.deficit|(raid_event.adds.in>40&combo_points.deficit>=4+talent.deeper_strategem.enabled+talent.anticipation.enabled)
actions.finish Finishers
# count action,conditions
0.00 enveloping_shadows,if=buff.enveloping_shadows.remains<target.time_to_die&buff.enveloping_shadows.remains<=combo_points*1.8
0.00 death_from_above,if=spell_targets.death_from_above>=6
L 17.04 nightblade,cycle_targets=1,if=target.time_to_die>8&((refreshable&(!finality|buff.finality_nightblade.up))|remains<tick_time)
0.00 death_from_above
M 59.07 eviscerate
actions.stealth_cds Stealth Cooldowns
# count action,conditions
R 3.66 shadow_dance,if=charges_fractional>=2.45
S 2.85 vanish
T 2.74 sprint_offensive
U 4.68 shadow_dance,if=charges>=2&combo_points<=1
0.00 pool_resource,for_next=1,extra_amount=40
0.00 shadowmeld,if=energy>=40&energy.deficit>=10+variable.ssw_refund
V 19.84 shadow_dance,if=combo_points<=1
actions.stealthed Stealthed Rotation
# count action,conditions
W 13.11 symbols_of_death,if=(buff.symbols_of_death.remains<target.time_to_die-4&buff.symbols_of_death.remains<=buff.symbols_of_death.duration*0.3)|equipped.shadow_satyrs_walk&energy.time_to_max<0.25
X 0.00 call_action_list,name=finish,if=combo_points>=5
0.00 shuriken_storm,if=buff.shadowmeld.down&((combo_points.deficit>=3&spell_targets.shuriken_storm>=2+talent.premeditation.enabled+equipped.shadow_satyrs_walk)|buff.the_dreadlords_deceit.stack>=29)
Y 111.33 shadowstrike

Sample Sequence

0124578AJIYYLRYMYYMSYYMRWYYMIYLTUYYMYYMGGMUWYMYYIMGGMUYYLWYYMKGMUYIYMYYLGGMUYYMYYGMUYYMYYMUYYYLWVYYMYYMVYYJHMYYLGGMVYYMYYMGGMVYYMYGLKGMVWYYMYYMGGMVWYYLYYMVYYMYYMSYYMTGGYMYGGLVYYMYGMVWYYYLGKMVWYYMYYMGGGGJLVYYMYGMVYYLYYMGGMVWYMYMGGLVYYMYYMGGMKGGLVYYMYYMVYWYMGGGLSYYYMTVWYYYMYGLGGJGMVYYMYGMVWYYMYKMG

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask CoF+AD 100.0/100: 100% energy | 0.0/6: 0% combo_points
Pre precombat 1 augmentation CoF+AD 100.0/100: 100% energy | 0.0/6: 0% combo_points
Pre precombat 2 food CoF+AD 100.0/100: 100% energy | 0.0/6: 0% combo_points
Pre precombat 4 stealth Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, stealth
Pre precombat 5 potion Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, stealth, potion_of_the_old_war
Pre precombat 7 ssw_refund Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, stealth, potion_of_the_old_war
Pre precombat 8 stealth_threshold Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, stealth, potion_of_the_old_war
Pre precombat A symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, stealth, symbols_of_death, death, potion_of_the_old_war
0:00.000 cds J shadow_blades Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, stealth, symbols_of_death, death, potion_of_the_old_war
0:00.000 cds I use_item_ring_of_collapsing_futures Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, stealth, symbols_of_death, shadow_blades, death, potion_of_the_old_war
0:00.000 stealthed Y shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points temptation, master_of_subtlety_aura, stealth, symbols_of_death, shadow_blades, death, potion_of_the_old_war
0:01.005 stealthed Y shadowstrike Fluffy_Pillow 80.3/100: 80% energy | 3.0/6: 50% combo_points bloodlust, temptation, master_of_subtlety_aura, stealth, subterfuge, symbols_of_death, shadow_blades, potion_of_the_old_war
0:02.008 finish L nightblade Fluffy_Pillow 85.6/100: 86% energy | 6.0/6: 100% combo_points bloodlust, temptation, master_of_subtlety_aura, stealth, subterfuge, symbols_of_death, shadow_blades, potion_of_the_old_war
0:03.013 stealth_cds R shadow_dance Fluffy_Pillow 100.0/100: 100% energy | 2.0/6: 33% combo_points bloodlust, temptation, master_of_subtlety, symbols_of_death, shadow_blades, finality_nightblade(6), potion_of_the_old_war
0:03.013 stealthed Y shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 2.0/6: 33% combo_points bloodlust, temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6), potion_of_the_old_war
0:04.017 finish M eviscerate Fluffy_Pillow 100.0/100: 100% energy | 5.0/6: 83% combo_points bloodlust, temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6), potion_of_the_old_war
0:05.020 stealthed Y shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points bloodlust, temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(5), finality_nightblade(6), potion_of_the_old_war
0:06.026 stealthed Y shadowstrike Fluffy_Pillow 80.3/100: 80% energy | 4.0/6: 67% combo_points bloodlust, temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(5), finality_nightblade(6), potion_of_the_old_war
0:07.030 finish M eviscerate Fluffy_Pillow 60.6/100: 61% energy | 6.0/6: 100% combo_points bloodlust, temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(5), finality_nightblade(6), potion_of_the_old_war
0:08.035 stealth_cds S vanish Fluffy_Pillow 79.9/100: 80% energy | 1.0/6: 17% combo_points bloodlust, temptation, master_of_subtlety, symbols_of_death, shadow_blades, finality_nightblade(6), potion_of_the_old_war
0:08.035 stealthed Y shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points bloodlust, temptation, master_of_subtlety_aura, vanish, symbols_of_death, shadow_blades, finality_nightblade(6), potion_of_the_old_war
0:09.040 stealthed Y shadowstrike Fluffy_Pillow 80.3/100: 80% energy | 4.0/6: 67% combo_points bloodlust, temptation, master_of_subtlety_aura, vanish, subterfuge, symbols_of_death, shadow_blades, finality_nightblade(6), potion_of_the_old_war
0:10.044 finish M eviscerate Fluffy_Pillow 60.6/100: 61% energy | 6.0/6: 100% combo_points bloodlust, temptation, master_of_subtlety_aura, vanish, subterfuge, symbols_of_death, shadow_blades, finality_nightblade(6), potion_of_the_old_war
0:11.049 stealth_cds R shadow_dance Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points bloodlust, temptation, master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6), potion_of_the_old_war
0:11.049 stealthed W symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points bloodlust, temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6), potion_of_the_old_war
0:11.049 stealthed Y shadowstrike Fluffy_Pillow 65.0/100: 65% energy | 1.0/6: 17% combo_points bloodlust, temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, death, finality_eviscerate(6), finality_nightblade(6), potion_of_the_old_war
0:12.054 stealthed Y shadowstrike Fluffy_Pillow 45.3/100: 45% energy | 4.0/6: 67% combo_points bloodlust, temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6), potion_of_the_old_war
0:13.057 Waiting     0.700 sec 25.6/100: 26% energy | 6.0/6: 100% combo_points bloodlust, temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6), potion_of_the_old_war
0:13.757 finish M eviscerate Fluffy_Pillow 35.6/100: 36% energy | 6.0/6: 100% combo_points bloodlust, temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6), potion_of_the_old_war
0:14.762 cds I use_item_ring_of_collapsing_futures Fluffy_Pillow 54.9/100: 55% energy | 0.0/6: 0% combo_points bloodlust, temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6), potion_of_the_old_war
0:15.000 stealthed Y shadowstrike Fluffy_Pillow 58.3/100: 58% energy | 0.0/6: 0% combo_points bloodlust, temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6), potion_of_the_old_war
0:16.003 finish L nightblade Fluffy_Pillow 38.6/100: 39% energy | 5.0/6: 83% combo_points bloodlust, temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6), potion_of_the_old_war
0:17.009 stealth_cds T sprint Fluffy_Pillow 67.9/100: 68% energy | 0.0/6: 0% combo_points bloodlust, temptation(2), master_of_subtlety, symbols_of_death, shadow_blades, potion_of_the_old_war
0:17.009 stealth_cds U shadow_dance Fluffy_Pillow 67.9/100: 68% energy | 0.0/6: 0% combo_points bloodlust, temptation(2), master_of_subtlety, sprint, symbols_of_death, shadow_blades, faster_than_light_trigger, potion_of_the_old_war
0:17.009 stealthed Y shadowstrike Fluffy_Pillow 92.9/100: 93% energy | 0.0/6: 0% combo_points bloodlust, temptation(2), master_of_subtlety_aura, shadow_dance, sprint, symbols_of_death, shadow_blades, faster_than_light_trigger, potion_of_the_old_war
0:18.015 stealthed Y shadowstrike Fluffy_Pillow 73.2/100: 73% energy | 3.0/6: 50% combo_points bloodlust, temptation(2), master_of_subtlety_aura, shadow_dance, sprint, symbols_of_death, shadow_blades, faster_than_light_trigger, potion_of_the_old_war
0:19.019 finish M eviscerate Fluffy_Pillow 53.5/100: 54% energy | 6.0/6: 100% combo_points bloodlust, temptation(2), master_of_subtlety_aura, shadow_dance, sprint, symbols_of_death, shadow_blades, faster_than_light_trigger, potion_of_the_old_war
0:20.023 stealthed Y shadowstrike Fluffy_Pillow 97.8/100: 98% energy | 0.0/6: 0% combo_points bloodlust, temptation(2), master_of_subtlety_aura, shadow_dance, vanish, subterfuge, sprint, symbols_of_death, shadow_blades, finality_eviscerate(6), potion_of_the_old_war
0:21.028 stealthed Y shadowstrike Fluffy_Pillow 78.1/100: 78% energy | 3.0/6: 50% combo_points bloodlust, temptation(2), master_of_subtlety_aura, shadow_dance, vanish, subterfuge, sprint, symbols_of_death, shadow_blades, finality_eviscerate(6), potion_of_the_old_war
0:22.032 finish M eviscerate Fluffy_Pillow 83.4/100: 83% energy | 6.0/6: 100% combo_points bloodlust, temptation(2), master_of_subtlety, vanish, subterfuge, sprint, symbols_of_death, shadow_blades, finality_eviscerate(6), potion_of_the_old_war
0:23.035 build G backstab Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points bloodlust, temptation(2), master_of_subtlety, sprint, symbols_of_death, shadow_blades
0:24.040 build G backstab Fluffy_Pillow 79.3/100: 79% energy | 3.0/6: 50% combo_points bloodlust, temptation(2), master_of_subtlety, sprint, symbols_of_death, shadow_blades
0:25.044 finish M eviscerate Fluffy_Pillow 58.6/100: 59% energy | 5.0/6: 83% combo_points bloodlust, temptation(2), master_of_subtlety, symbols_of_death, shadow_blades
0:26.048 stealth_cds U shadow_dance Fluffy_Pillow 77.9/100: 78% energy | 0.0/6: 0% combo_points bloodlust, temptation(2), master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(5)
0:26.048 stealthed W symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points bloodlust, temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(5)
0:26.048 stealthed Y shadowstrike Fluffy_Pillow 65.0/100: 65% energy | 0.0/6: 0% combo_points bloodlust, temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, death, finality_eviscerate(5)
0:27.051 finish M eviscerate Fluffy_Pillow 45.3/100: 45% energy | 5.0/6: 83% combo_points bloodlust, temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(5)
0:28.056 stealthed Y shadowstrike Fluffy_Pillow 64.6/100: 65% energy | 0.0/6: 0% combo_points bloodlust, temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades
0:29.060 stealthed Y shadowstrike Fluffy_Pillow 44.9/100: 45% energy | 3.0/6: 50% combo_points bloodlust, temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades
0:30.065 cds I use_item_ring_of_collapsing_futures Fluffy_Pillow 50.2/100: 50% energy | 6.0/6: 100% combo_points bloodlust, temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades
0:30.065 finish M eviscerate Fluffy_Pillow 50.2/100: 50% energy | 6.0/6: 100% combo_points bloodlust, temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades
0:31.071 build G backstab Fluffy_Pillow 100.0/100: 100% energy | 2.0/6: 33% combo_points bloodlust, temptation(3), master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6)
0:32.076 build G backstab Fluffy_Pillow 79.3/100: 79% energy | 4.0/6: 67% combo_points bloodlust, temptation(3), master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6)
0:33.079 finish M eviscerate Fluffy_Pillow 58.6/100: 59% energy | 6.0/6: 100% combo_points bloodlust, temptation(3), master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6)
0:34.083 stealth_cds U shadow_dance Fluffy_Pillow 77.9/100: 78% energy | 0.0/6: 0% combo_points bloodlust, temptation(3), master_of_subtlety, symbols_of_death, shadow_blades
0:34.083 stealthed Y shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points bloodlust, temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades
0:35.087 stealthed Y shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 3.0/6: 50% combo_points bloodlust, temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades
0:36.090 finish L nightblade Fluffy_Pillow 80.3/100: 80% energy | 6.0/6: 100% combo_points bloodlust, temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades
0:37.094 stealthed W symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points bloodlust, temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6)
0:37.094 stealthed Y shadowstrike Fluffy_Pillow 65.0/100: 65% energy | 0.0/6: 0% combo_points bloodlust, temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, death, finality_nightblade(6)
0:38.099 stealthed Y shadowstrike Fluffy_Pillow 45.3/100: 45% energy | 4.0/6: 67% combo_points bloodlust, temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6)
0:39.103 Waiting     0.700 sec 25.6/100: 26% energy | 6.0/6: 100% combo_points bloodlust, temptation(3), master_of_subtlety, symbols_of_death, shadow_blades, finality_nightblade(6)
0:39.803 finish M eviscerate Fluffy_Pillow 35.6/100: 36% energy | 6.0/6: 100% combo_points bloodlust, temptation(3), master_of_subtlety, symbols_of_death, shadow_blades, finality_nightblade(6)
0:40.807 cds K goremaws_bite Fluffy_Pillow 54.9/100: 55% energy | 0.0/6: 0% combo_points bloodlust, temptation(3), master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6)
0:41.811 build G backstab Fluffy_Pillow 70.9/100: 71% energy | 4.0/6: 67% combo_points temptation(3), master_of_subtlety, symbols_of_death, shadow_blades, goremaws_bite, finality_eviscerate(6), finality_nightblade(6)
0:42.817 finish M eviscerate Fluffy_Pillow 51.9/100: 52% energy | 6.0/6: 100% combo_points temptation(3), master_of_subtlety, symbols_of_death, shadow_blades, goremaws_bite, finality_eviscerate(6), finality_nightblade(6)
0:43.822 stealth_cds U shadow_dance Fluffy_Pillow 72.9/100: 73% energy | 0.0/6: 0% combo_points temptation(3), master_of_subtlety, symbols_of_death, shadow_blades, goremaws_bite, finality_nightblade(6)
0:43.822 stealthed Y shadowstrike Fluffy_Pillow 97.9/100: 98% energy | 0.0/6: 0% combo_points temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, goremaws_bite, finality_nightblade(6)
0:44.827 cds I use_item_ring_of_collapsing_futures Fluffy_Pillow 79.9/100: 80% energy | 3.0/6: 50% combo_points temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, goremaws_bite, finality_nightblade(6)
0:45.065 stealthed Y shadowstrike Fluffy_Pillow 82.5/100: 83% energy | 4.0/6: 67% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, goremaws_bite, finality_nightblade(6)
0:46.069 finish M eviscerate Fluffy_Pillow 64.5/100: 65% energy | 6.0/6: 100% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, goremaws_bite, finality_nightblade(6)
0:47.073 stealthed Y shadowstrike Fluffy_Pillow 85.5/100: 86% energy | 0.0/6: 0% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6)
0:48.076 stealthed Y shadowstrike Fluffy_Pillow 62.5/100: 63% energy | 3.0/6: 50% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6)
0:49.081 finish L nightblade Fluffy_Pillow 39.5/100: 40% energy | 6.0/6: 100% combo_points temptation(4), master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6)
0:50.084 build G backstab Fluffy_Pillow 65.5/100: 66% energy | 2.0/6: 33% combo_points temptation(4), master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6)
0:51.088 Waiting     0.900 sec 41.5/100: 42% energy | 4.0/6: 67% combo_points temptation(4), master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6)
0:51.988 build G backstab Fluffy_Pillow 51.4/100: 51% energy | 4.0/6: 67% combo_points temptation(4), master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6)
0:52.993 Waiting     0.700 sec 27.4/100: 27% energy | 6.0/6: 100% combo_points temptation(4), master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6)
0:53.693 finish M eviscerate Fluffy_Pillow 35.0/100: 35% energy | 6.0/6: 100% combo_points temptation(4), master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6)
0:54.698 stealth_cds U shadow_dance Fluffy_Pillow 51.1/100: 51% energy | 0.0/6: 0% combo_points temptation(4), symbols_of_death, shadow_blades
0:54.698 stealthed Y shadowstrike Fluffy_Pillow 76.1/100: 76% energy | 0.0/6: 0% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades
0:55.702 stealthed Y shadowstrike Fluffy_Pillow 78.1/100: 78% energy | 3.0/6: 50% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades
0:56.706 finish M eviscerate Fluffy_Pillow 80.1/100: 80% energy | 6.0/6: 100% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death
0:57.712 stealthed Y shadowstrike Fluffy_Pillow 96.1/100: 96% energy | 0.0/6: 0% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6)
0:58.718 stealthed Y shadowstrike Fluffy_Pillow 73.1/100: 73% energy | 2.0/6: 33% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6)
0:59.723 Waiting     0.100 sec 50.1/100: 50% energy | 4.0/6: 67% combo_points temptation(4), master_of_subtlety, symbols_of_death, finality_eviscerate(6)
0:59.823 build G backstab Fluffy_Pillow 51.2/100: 51% energy | 4.0/6: 67% combo_points temptation(4), master_of_subtlety, symbols_of_death, finality_eviscerate(6)
1:00.828 Waiting     0.800 sec 27.2/100: 27% energy | 5.0/6: 83% combo_points temptation(4), master_of_subtlety, symbols_of_death, finality_eviscerate(6)
1:01.628 finish M eviscerate Fluffy_Pillow 36.0/100: 36% energy | 6.0/6: 100% combo_points temptation(4), master_of_subtlety, symbols_of_death, finality_eviscerate(6)
1:02.632 stealth_cds U shadow_dance Fluffy_Pillow 52.0/100: 52% energy | 0.0/6: 0% combo_points temptation(4), master_of_subtlety, symbols_of_death
1:02.632 stealthed Y shadowstrike Fluffy_Pillow 77.0/100: 77% energy | 0.0/6: 0% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death
1:03.635 stealthed Y shadowstrike Fluffy_Pillow 54.0/100: 54% energy | 2.0/6: 33% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death
1:04.641 Waiting     0.400 sec 31.0/100: 31% energy | 5.0/6: 83% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death
1:05.041 finish M eviscerate Fluffy_Pillow 35.4/100: 35% energy | 5.0/6: 83% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death
1:06.046 stealthed Y shadowstrike Fluffy_Pillow 51.4/100: 51% energy | 0.0/6: 0% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5)
1:07.050 stealthed Y shadowstrike Fluffy_Pillow 53.4/100: 53% energy | 2.0/6: 33% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5)
1:08.056 finish M eviscerate Fluffy_Pillow 55.4/100: 55% energy | 5.0/6: 83% combo_points temptation(4), master_of_subtlety, symbols_of_death, finality_eviscerate(5)
1:09.061 stealth_cds U shadow_dance Fluffy_Pillow 71.4/100: 71% energy | 0.0/6: 0% combo_points temptation(4), master_of_subtlety, symbols_of_death
1:09.061 stealthed Y shadowstrike Fluffy_Pillow 96.4/100: 96% energy | 0.0/6: 0% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death
1:10.063 stealthed Y shadowstrike Fluffy_Pillow 73.4/100: 73% energy | 2.0/6: 33% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death
1:11.067 stealthed Y shadowstrike Fluffy_Pillow 50.4/100: 50% energy | 4.0/6: 67% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death
1:12.073 finish L nightblade Fluffy_Pillow 27.4/100: 27% energy | 6.0/6: 100% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death
1:13.078 stealthed W symbols_of_death Fluffy_Pillow 53.4/100: 53% energy | 1.0/6: 17% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(6)
1:13.078 Waiting     1.002 sec 18.4/100: 18% energy | 1.0/6: 17% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death, death, finality_nightblade(6)
1:14.080 stealth_cds V shadow_dance Fluffy_Pillow 29.4/100: 29% energy | 1.0/6: 17% combo_points temptation(4), master_of_subtlety, symbols_of_death, death, finality_nightblade(6)
1:14.080 stealthed Y shadowstrike Fluffy_Pillow 54.4/100: 54% energy | 1.0/6: 17% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death, death, finality_nightblade(6)
1:15.084 stealthed Y shadowstrike Fluffy_Pillow 56.4/100: 56% energy | 3.0/6: 50% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(6)
1:16.089 finish M eviscerate Fluffy_Pillow 58.4/100: 58% energy | 5.0/6: 83% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(6)
1:17.092 stealthed Y shadowstrike Fluffy_Pillow 74.4/100: 74% energy | 1.0/6: 17% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5), finality_nightblade(6)
1:18.095 stealthed Y shadowstrike Fluffy_Pillow 51.4/100: 51% energy | 3.0/6: 50% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5), finality_nightblade(6)
1:19.101 finish M eviscerate Fluffy_Pillow 53.4/100: 53% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5), finality_nightblade(6)
1:20.105 stealth_cds V shadow_dance Fluffy_Pillow 69.4/100: 69% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, finality_nightblade(6)
1:20.105 stealthed Y shadowstrike Fluffy_Pillow 94.4/100: 94% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(6)
1:21.108 stealthed Y shadowstrike Fluffy_Pillow 71.4/100: 71% energy | 3.0/6: 50% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(6)
1:22.113 cds J shadow_blades Fluffy_Pillow 73.4/100: 73% energy | 5.0/6: 83% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(6)
1:22.113 cds H potion Fluffy_Pillow 73.4/100: 73% energy | 5.0/6: 83% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6)
1:22.113 finish M eviscerate Fluffy_Pillow 73.4/100: 73% energy | 5.0/6: 83% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6), potion_of_the_old_war
1:23.119 stealthed Y shadowstrike Fluffy_Pillow 89.4/100: 89% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(5), finality_nightblade(6), potion_of_the_old_war
1:24.123 stealthed Y shadowstrike Fluffy_Pillow 91.4/100: 91% energy | 3.0/6: 50% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(5), finality_nightblade(6), potion_of_the_old_war
1:25.127 finish L nightblade Fluffy_Pillow 68.4/100: 68% energy | 6.0/6: 100% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(5), finality_nightblade(6), potion_of_the_old_war
1:26.131 build G backstab Fluffy_Pillow 94.4/100: 94% energy | 2.0/6: 33% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(5), potion_of_the_old_war
1:27.136 build G backstab Fluffy_Pillow 70.4/100: 70% energy | 4.0/6: 67% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(5), potion_of_the_old_war
1:28.142 finish M eviscerate Fluffy_Pillow 46.4/100: 46% energy | 6.0/6: 100% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(5), potion_of_the_old_war
1:29.147 stealth_cds V shadow_dance Fluffy_Pillow 62.4/100: 62% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, shadow_blades, potion_of_the_old_war
1:29.147 stealthed Y shadowstrike Fluffy_Pillow 87.4/100: 87% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, potion_of_the_old_war
1:30.151 stealthed Y shadowstrike Fluffy_Pillow 89.4/100: 89% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, potion_of_the_old_war
1:31.155 finish M eviscerate Fluffy_Pillow 66.4/100: 66% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, potion_of_the_old_war
1:32.160 stealthed Y shadowstrike Fluffy_Pillow 82.4/100: 82% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), potion_of_the_old_war
1:33.166 stealthed Y shadowstrike Fluffy_Pillow 84.5/100: 84% energy | 3.0/6: 50% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), potion_of_the_old_war
1:34.171 finish M eviscerate Fluffy_Pillow 61.5/100: 61% energy | 6.0/6: 100% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), potion_of_the_old_war
1:35.174 build G backstab Fluffy_Pillow 77.5/100: 77% energy | 1.0/6: 17% combo_points master_of_subtlety, symbols_of_death, shadow_blades, potion_of_the_old_war
1:36.177 build G backstab Fluffy_Pillow 53.5/100: 53% energy | 3.0/6: 50% combo_points master_of_subtlety, symbols_of_death, shadow_blades, potion_of_the_old_war
1:37.180 Waiting     0.600 sec 29.4/100: 29% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death, shadow_blades, potion_of_the_old_war
1:37.780 finish M eviscerate Fluffy_Pillow 36.0/100: 36% energy | 6.0/6: 100% combo_points master_of_subtlety, symbols_of_death, shadow_blades, potion_of_the_old_war
1:38.784 stealth_cds V shadow_dance Fluffy_Pillow 52.0/100: 52% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), potion_of_the_old_war
1:38.784 stealthed Y shadowstrike Fluffy_Pillow 77.0/100: 77% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), potion_of_the_old_war
1:39.787 stealthed Y shadowstrike Fluffy_Pillow 54.0/100: 54% energy | 3.0/6: 50% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), potion_of_the_old_war
1:40.792 Waiting     0.400 sec 31.0/100: 31% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), potion_of_the_old_war
1:41.192 finish M eviscerate Fluffy_Pillow 35.4/100: 35% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), potion_of_the_old_war
1:42.194 stealthed Y shadowstrike Fluffy_Pillow 51.4/100: 51% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, potion_of_the_old_war
1:43.199 Waiting     2.100 sec 28.4/100: 28% energy | 3.0/6: 50% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, potion_of_the_old_war
1:45.299 build G backstab Fluffy_Pillow 51.4/100: 51% energy | 4.0/6: 67% combo_points master_of_subtlety, symbols_of_death, shadow_blades, potion_of_the_old_war
1:46.304 finish L nightblade Fluffy_Pillow 27.4/100: 27% energy | 6.0/6: 100% combo_points master_of_subtlety, symbols_of_death, shadow_blades, potion_of_the_old_war
1:47.308 cds K goremaws_bite Fluffy_Pillow 53.4/100: 53% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_nightblade(6)
1:48.314 build G backstab Fluffy_Pillow 69.4/100: 69% energy | 4.0/6: 67% combo_points master_of_subtlety, symbols_of_death, shadow_blades, goremaws_bite, finality_nightblade(6)
1:49.320 finish M eviscerate Fluffy_Pillow 50.4/100: 50% energy | 6.0/6: 100% combo_points symbols_of_death, shadow_blades, goremaws_bite, finality_nightblade(6)
1:50.326 stealth_cds V shadow_dance Fluffy_Pillow 71.5/100: 71% energy | 0.0/6: 0% combo_points symbols_of_death, shadow_blades, goremaws_bite, finality_eviscerate(6), finality_nightblade(6)
1:50.326 stealthed W symbols_of_death Fluffy_Pillow 96.5/100: 96% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, goremaws_bite, finality_eviscerate(6), finality_nightblade(6)
1:50.326 stealthed Y shadowstrike Fluffy_Pillow 61.5/100: 61% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, goremaws_bite, death, finality_eviscerate(6), finality_nightblade(6)
1:51.328 stealthed Y shadowstrike Fluffy_Pillow 43.4/100: 43% energy | 3.0/6: 50% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, goremaws_bite, finality_eviscerate(6), finality_nightblade(6)
1:52.331 finish M eviscerate Fluffy_Pillow 50.4/100: 50% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, goremaws_bite, finality_eviscerate(6), finality_nightblade(6)
1:53.335 stealthed Y shadowstrike Fluffy_Pillow 71.4/100: 71% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6)
1:54.341 stealthed Y shadowstrike Fluffy_Pillow 48.4/100: 48% energy | 3.0/6: 50% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6)
1:55.345 Waiting     0.900 sec 25.4/100: 25% energy | 6.0/6: 100% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_nightblade(6)
1:56.245 finish M eviscerate Fluffy_Pillow 35.3/100: 35% energy | 6.0/6: 100% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_nightblade(6)
1:57.249 build G backstab Fluffy_Pillow 91.3/100: 91% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6)
1:58.255 build G backstab Fluffy_Pillow 67.3/100: 67% energy | 2.0/6: 33% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6)
1:59.260 finish M eviscerate Fluffy_Pillow 43.3/100: 43% energy | 6.0/6: 100% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6)
2:00.265 stealth_cds V shadow_dance Fluffy_Pillow 99.3/100: 99% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_nightblade(6)
2:00.265 stealthed W symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6)
2:00.326 stealthed Y shadowstrike Fluffy_Pillow 65.0/100: 65% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, death, finality_nightblade(6)
2:01.329 stealthed Y shadowstrike Fluffy_Pillow 42.0/100: 42% energy | 3.0/6: 50% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6)
2:02.334 Waiting     0.647 sec 19.0/100: 19% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6)
2:02.981 finish L nightblade Fluffy_Pillow 26.1/100: 26% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6)
2:03.984 stealthed Y shadowstrike Fluffy_Pillow 52.1/100: 52% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades
2:04.988 stealthed Y shadowstrike Fluffy_Pillow 54.1/100: 54% energy | 3.0/6: 50% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades
2:05.994 Waiting     0.400 sec 31.1/100: 31% energy | 6.0/6: 100% combo_points master_of_subtlety, symbols_of_death, shadow_blades
2:06.394 finish M eviscerate Fluffy_Pillow 35.5/100: 35% energy | 6.0/6: 100% combo_points master_of_subtlety, symbols_of_death, shadow_blades
2:07.398 stealth_cds V shadow_dance Fluffy_Pillow 91.5/100: 91% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6)
2:07.398 stealthed Y shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6)
2:08.402 stealthed Y shadowstrike Fluffy_Pillow 77.0/100: 77% energy | 3.0/6: 50% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6)
2:09.407 finish M eviscerate Fluffy_Pillow 54.0/100: 54% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6)
2:10.414 stealthed Y shadowstrike Fluffy_Pillow 70.0/100: 70% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades
2:11.418 stealthed Y shadowstrike Fluffy_Pillow 47.0/100: 47% energy | 3.0/6: 50% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades
2:12.421 Waiting     1.100 sec 24.0/100: 24% energy | 6.0/6: 100% combo_points master_of_subtlety, symbols_of_death, shadow_blades
2:13.521 finish M eviscerate Fluffy_Pillow 36.1/100: 36% energy | 6.0/6: 100% combo_points master_of_subtlety, symbols_of_death, shadow_blades
2:14.524 stealth_cds S vanish Fluffy_Pillow 52.1/100: 52% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6)
2:14.524 stealthed Y shadowstrike Fluffy_Pillow 77.1/100: 77% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, vanish, symbols_of_death, shadow_blades, finality_eviscerate(6)
2:15.529 stealthed Y shadowstrike Fluffy_Pillow 54.1/100: 54% energy | 3.0/6: 50% combo_points master_of_subtlety_aura, vanish, subterfuge, symbols_of_death, shadow_blades, finality_eviscerate(6)
2:16.533 Waiting     0.400 sec 31.1/100: 31% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, vanish, subterfuge, symbols_of_death, finality_eviscerate(6)
2:16.933 finish M eviscerate Fluffy_Pillow 35.5/100: 35% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, vanish, subterfuge, symbols_of_death, finality_eviscerate(6)
2:17.938 stealth_cds T sprint Fluffy_Pillow 76.5/100: 76% energy | 2.0/6: 33% combo_points master_of_subtlety, symbols_of_death
2:17.938 build G backstab Fluffy_Pillow 76.5/100: 76% energy | 2.0/6: 33% combo_points master_of_subtlety, sprint, symbols_of_death, faster_than_light_trigger
2:18.943 build G backstab Fluffy_Pillow 52.5/100: 52% energy | 3.0/6: 50% combo_points master_of_subtlety, sprint, symbols_of_death, faster_than_light_trigger
2:19.947 Waiting     1.000 sec 28.5/100: 28% energy | 4.0/6: 67% combo_points master_of_subtlety, sprint, symbols_of_death, faster_than_light_trigger
2:20.947 stealthed Y shadowstrike Fluffy_Pillow 64.4/100: 64% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, vanish, subterfuge, sprint, symbols_of_death
2:21.952 finish M eviscerate Fluffy_Pillow 41.4/100: 41% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, vanish, subterfuge, sprint, symbols_of_death
2:22.958 stealthed Y shadowstrike Fluffy_Pillow 57.5/100: 57% energy | 1.0/6: 17% combo_points master_of_subtlety_aura, vanish, subterfuge, sprint, symbols_of_death, finality_eviscerate(6)
2:23.963 build G backstab Fluffy_Pillow 59.5/100: 59% energy | 3.0/6: 50% combo_points master_of_subtlety, sprint, symbols_of_death, finality_eviscerate(6)
2:24.968 Waiting     1.500 sec 35.5/100: 35% energy | 4.0/6: 67% combo_points master_of_subtlety, sprint, symbols_of_death, finality_eviscerate(6)
2:26.468 build G backstab Fluffy_Pillow 51.9/100: 52% energy | 4.0/6: 67% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(6)
2:27.473 finish L nightblade Fluffy_Pillow 27.9/100: 28% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(6)
2:28.477 stealth_cds V shadow_dance Fluffy_Pillow 53.9/100: 54% energy | 1.0/6: 17% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(6), finality_nightblade(5)
2:28.477 stealthed Y shadowstrike Fluffy_Pillow 78.9/100: 79% energy | 1.0/6: 17% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6), finality_nightblade(5)
2:29.482 stealthed Y shadowstrike Fluffy_Pillow 55.9/100: 56% energy | 3.0/6: 50% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6), finality_nightblade(5)
2:30.490 Waiting     0.200 sec 33.0/100: 33% energy | 5.0/6: 83% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6), finality_nightblade(5)
2:30.690 finish M eviscerate Fluffy_Pillow 35.2/100: 35% energy | 5.0/6: 83% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6), finality_nightblade(5)
2:31.694 stealthed Y shadowstrike Fluffy_Pillow 51.2/100: 51% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(5)
2:32.698 Waiting     2.100 sec 28.2/100: 28% energy | 3.0/6: 50% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(5)
2:34.798 build G backstab Fluffy_Pillow 51.2/100: 51% energy | 3.0/6: 50% combo_points master_of_subtlety, symbols_of_death, finality_nightblade(5)
2:35.802 Waiting     0.800 sec 27.2/100: 27% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death, finality_nightblade(5)
2:36.602 finish M eviscerate Fluffy_Pillow 35.9/100: 36% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death, finality_nightblade(5)
2:37.607 stealth_cds V shadow_dance Fluffy_Pillow 51.9/100: 52% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5), finality_nightblade(5)
2:37.607 stealthed W symbols_of_death Fluffy_Pillow 76.9/100: 77% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5), finality_nightblade(5)
2:37.607 stealthed Y shadowstrike Fluffy_Pillow 41.9/100: 42% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, death, finality_eviscerate(5), finality_nightblade(5)
2:38.612 stealthed Y shadowstrike Fluffy_Pillow 43.9/100: 44% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5), finality_nightblade(5)
2:39.615 Waiting     1.771 sec 20.9/100: 21% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5), finality_nightblade(5)
2:41.386 stealthed Y shadowstrike Fluffy_Pillow 40.3/100: 40% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5), finality_nightblade(5)
2:42.391 Waiting     0.798 sec 17.3/100: 17% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5), finality_nightblade(5)
2:43.189 finish L nightblade Fluffy_Pillow 26.1/100: 26% energy | 6.0/6: 100% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5), finality_nightblade(5)
2:44.194 build G backstab Fluffy_Pillow 52.1/100: 52% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5)
2:45.198 Waiting     1.900 sec 28.1/100: 28% energy | 1.0/6: 17% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5)
2:47.098 cds K goremaws_bite Fluffy_Pillow 48.9/100: 49% energy | 1.0/6: 17% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5)
2:48.312 finish M eviscerate Fluffy_Pillow 67.2/100: 67% energy | 5.0/6: 83% combo_points symbols_of_death, goremaws_bite, finality_eviscerate(5)
2:49.316 stealth_cds V shadow_dance Fluffy_Pillow 88.2/100: 88% energy | 0.0/6: 0% combo_points symbols_of_death, goremaws_bite
2:49.316 stealthed W symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, goremaws_bite
2:49.316 stealthed Y shadowstrike Fluffy_Pillow 65.0/100: 65% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, goremaws_bite, death
2:50.321 stealthed Y shadowstrike Fluffy_Pillow 47.0/100: 47% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, goremaws_bite
2:51.326 Waiting     0.600 sec 29.0/100: 29% energy | 5.0/6: 83% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, goremaws_bite
2:51.926 finish M eviscerate Fluffy_Pillow 35.6/100: 36% energy | 5.0/6: 83% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, goremaws_bite
2:52.931 stealthed Y shadowstrike Fluffy_Pillow 56.6/100: 57% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, goremaws_bite, finality_eviscerate(5)
2:53.934 stealthed Y shadowstrike Fluffy_Pillow 63.6/100: 64% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5)
2:54.939 Waiting     0.600 sec 40.6/100: 41% energy | 4.0/6: 67% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5)
2:55.539 finish M eviscerate Fluffy_Pillow 47.2/100: 47% energy | 6.0/6: 100% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5)
2:56.544 build G backstab Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death
2:57.549 build G backstab Fluffy_Pillow 76.0/100: 76% energy | 1.0/6: 17% combo_points master_of_subtlety, symbols_of_death
2:58.552 build G backstab Fluffy_Pillow 52.0/100: 52% energy | 2.0/6: 33% combo_points master_of_subtlety, symbols_of_death
2:59.557 Waiting     2.100 sec 28.0/100: 28% energy | 3.0/6: 50% combo_points symbols_of_death
3:01.657 build G backstab Fluffy_Pillow 51.0/100: 51% energy | 4.0/6: 67% combo_points symbols_of_death
3:02.663 cds J shadow_blades Fluffy_Pillow 27.0/100: 27% energy | 5.0/6: 83% combo_points symbols_of_death
3:02.663 finish L nightblade Fluffy_Pillow 27.0/100: 27% energy | 5.0/6: 83% combo_points symbols_of_death, shadow_blades
3:03.666 stealth_cds V shadow_dance Fluffy_Pillow 53.0/100: 53% energy | 0.0/6: 0% combo_points symbols_of_death, shadow_blades, finality_nightblade(5)
3:03.666 stealthed Y shadowstrike Fluffy_Pillow 78.0/100: 78% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(5)
3:04.669 stealthed Y shadowstrike Fluffy_Pillow 55.0/100: 55% energy | 3.0/6: 50% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(5)
3:05.673 Waiting     0.300 sec 32.0/100: 32% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(5)
3:05.973 finish M eviscerate Fluffy_Pillow 35.3/100: 35% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(5)
3:06.976 stealthed Y shadowstrike Fluffy_Pillow 51.3/100: 51% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(5)
3:07.980 Waiting     2.100 sec 28.3/100: 28% energy | 3.0/6: 50% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(5)
3:10.080 build G backstab Fluffy_Pillow 51.3/100: 51% energy | 4.0/6: 67% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(5)
3:11.084 Waiting     0.800 sec 27.3/100: 27% energy | 6.0/6: 100% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(5)
3:11.884 finish M eviscerate Fluffy_Pillow 36.0/100: 36% energy | 6.0/6: 100% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(5)
3:12.889 stealth_cds V shadow_dance Fluffy_Pillow 52.1/100: 52% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_nightblade(5)
3:12.889 stealthed Y shadowstrike Fluffy_Pillow 77.1/100: 77% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(5)
3:13.894 stealthed Y shadowstrike Fluffy_Pillow 54.1/100: 54% energy | 3.0/6: 50% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(5)
3:14.899 finish L nightblade Fluffy_Pillow 31.1/100: 31% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(5)
3:15.902 stealthed Y shadowstrike Fluffy_Pillow 57.1/100: 57% energy | 1.0/6: 17% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades
3:16.907 Waiting     0.600 sec 34.1/100: 34% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades
3:17.507 stealthed Y shadowstrike Fluffy_Pillow 40.6/100: 41% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades
3:18.514 Waiting     1.668 sec 17.7/100: 18% energy | 6.0/6: 100% combo_points master_of_subtlety, symbols_of_death, shadow_blades
3:20.182 finish M eviscerate Fluffy_Pillow 36.0/100: 36% energy | 6.0/6: 100% combo_points master_of_subtlety, symbols_of_death, shadow_blades
3:21.186 build G backstab Fluffy_Pillow 52.0/100: 52% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6)
3:22.191 Waiting     2.200 sec 28.0/100: 28% energy | 2.0/6: 33% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6)
3:24.391 build G backstab Fluffy_Pillow 52.1/100: 52% energy | 3.0/6: 50% combo_points symbols_of_death, shadow_blades, finality_eviscerate(6)
3:25.395 Waiting     0.700 sec 28.1/100: 28% energy | 5.0/6: 83% combo_points symbols_of_death, shadow_blades, finality_eviscerate(6)
3:26.095 finish M eviscerate Fluffy_Pillow 35.7/100: 36% energy | 5.0/6: 83% combo_points symbols_of_death, shadow_blades, finality_eviscerate(6)
3:27.098 stealth_cds V shadow_dance Fluffy_Pillow 51.7/100: 52% energy | 1.0/6: 17% combo_points symbols_of_death, shadow_blades
3:27.098 stealthed W symbols_of_death Fluffy_Pillow 76.7/100: 77% energy | 1.0/6: 17% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades
3:27.098 stealthed Y shadowstrike Fluffy_Pillow 41.7/100: 42% energy | 1.0/6: 17% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, death
3:28.102 Waiting     1.873 sec 18.7/100: 19% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades
3:29.975 finish M eviscerate Fluffy_Pillow 39.2/100: 39% energy | 5.0/6: 83% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades
3:30.980 stealthed Y shadowstrike Fluffy_Pillow 55.2/100: 55% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(5)
3:31.984 Waiting     1.300 sec 32.2/100: 32% energy | 3.0/6: 50% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(5)
3:33.284 finish M eviscerate Fluffy_Pillow 46.5/100: 46% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(5)
3:34.289 build G backstab Fluffy_Pillow 62.5/100: 62% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, shadow_blades
3:35.293 Waiting     1.200 sec 38.5/100: 38% energy | 2.0/6: 33% combo_points master_of_subtlety, symbols_of_death, shadow_blades
3:36.493 build G backstab Fluffy_Pillow 51.6/100: 52% energy | 2.0/6: 33% combo_points master_of_subtlety, symbols_of_death, shadow_blades
3:37.496 finish L nightblade Fluffy_Pillow 27.6/100: 28% energy | 5.0/6: 83% combo_points symbols_of_death, shadow_blades
3:38.501 stealth_cds V shadow_dance Fluffy_Pillow 53.6/100: 54% energy | 0.0/6: 0% combo_points symbols_of_death, shadow_blades, finality_nightblade(5)
3:38.501 stealthed Y shadowstrike Fluffy_Pillow 78.6/100: 79% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(5)
3:39.507 stealthed Y shadowstrike Fluffy_Pillow 55.7/100: 56% energy | 3.0/6: 50% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(5)
3:40.513 Waiting     0.300 sec 32.7/100: 33% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(5)
3:40.813 finish M eviscerate Fluffy_Pillow 36.0/100: 36% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(5)
3:41.818 stealthed Y shadowstrike Fluffy_Pillow 92.0/100: 92% energy | 1.0/6: 17% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(5)
3:42.822 stealthed Y shadowstrike Fluffy_Pillow 69.0/100: 69% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(5)
3:43.828 finish M eviscerate Fluffy_Pillow 71.0/100: 71% energy | 6.0/6: 100% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(5)
3:44.833 build G backstab Fluffy_Pillow 87.0/100: 87% energy | 1.0/6: 17% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_nightblade(5)
3:45.835 build G backstab Fluffy_Pillow 63.0/100: 63% energy | 3.0/6: 50% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_nightblade(5)
3:46.840 finish M eviscerate Fluffy_Pillow 39.0/100: 39% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death, finality_nightblade(5)
3:47.845 cds K goremaws_bite Fluffy_Pillow 55.0/100: 55% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5), finality_nightblade(5)
3:48.850 build G backstab Fluffy_Pillow 71.0/100: 71% energy | 3.0/6: 50% combo_points symbols_of_death, goremaws_bite, finality_eviscerate(5), finality_nightblade(5)
3:49.856 build G backstab Fluffy_Pillow 52.0/100: 52% energy | 4.0/6: 67% combo_points symbols_of_death, goremaws_bite, finality_eviscerate(5), finality_nightblade(5)
3:50.861 finish L nightblade Fluffy_Pillow 33.0/100: 33% energy | 5.0/6: 83% combo_points symbols_of_death, goremaws_bite, finality_eviscerate(5), finality_nightblade(5)
3:51.866 stealth_cds V shadow_dance Fluffy_Pillow 64.0/100: 64% energy | 0.0/6: 0% combo_points symbols_of_death, goremaws_bite, finality_eviscerate(5)
3:51.866 stealthed Y shadowstrike Fluffy_Pillow 89.0/100: 89% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, goremaws_bite, finality_eviscerate(5)
3:52.870 stealthed Y shadowstrike Fluffy_Pillow 71.0/100: 71% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, goremaws_bite, finality_eviscerate(5)
3:53.875 finish M eviscerate Fluffy_Pillow 53.1/100: 53% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5)
3:54.878 stealthed Y shadowstrike Fluffy_Pillow 69.0/100: 69% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
3:55.885 stealthed Y shadowstrike Fluffy_Pillow 46.1/100: 46% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
3:56.890 Waiting     1.174 sec 23.1/100: 23% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death
3:58.064 finish M eviscerate Fluffy_Pillow 35.9/100: 36% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death
3:59.069 stealth_cds V shadow_dance Fluffy_Pillow 52.0/100: 52% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5)
3:59.069 stealthed Y shadowstrike Fluffy_Pillow 77.0/100: 77% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5)
4:00.073 stealthed W symbols_of_death Fluffy_Pillow 54.0/100: 54% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5)
4:00.073 Waiting     1.951 sec 19.0/100: 19% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, death, finality_eviscerate(5)
4:02.024 stealthed Y shadowstrike Fluffy_Pillow 40.3/100: 40% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, death, finality_eviscerate(5)
4:03.028 Waiting     1.700 sec 17.3/100: 17% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5)
4:04.728 finish M eviscerate Fluffy_Pillow 36.0/100: 36% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5)
4:05.732 build G backstab Fluffy_Pillow 51.9/100: 52% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death
4:06.735 Waiting     2.200 sec 27.9/100: 28% energy | 1.0/6: 17% combo_points master_of_subtlety, symbols_of_death
4:08.935 build G backstab Fluffy_Pillow 52.0/100: 52% energy | 2.0/6: 33% combo_points master_of_subtlety, symbols_of_death
4:09.940 Waiting     2.100 sec 28.0/100: 28% energy | 3.0/6: 50% combo_points symbols_of_death
4:12.040 build G backstab Fluffy_Pillow 51.1/100: 51% energy | 3.0/6: 50% combo_points symbols_of_death
4:13.045 Waiting     1.300 sec 27.1/100: 27% energy | 4.0/6: 67% combo_points symbols_of_death
4:14.345 finish L nightblade Fluffy_Pillow 41.3/100: 41% energy | 5.0/6: 83% combo_points symbols_of_death
4:15.352 stealth_cds S vanish Fluffy_Pillow 67.3/100: 67% energy | 0.0/6: 0% combo_points symbols_of_death, finality_nightblade(5)
4:15.352 stealthed Y shadowstrike Fluffy_Pillow 92.3/100: 92% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, vanish, symbols_of_death, finality_nightblade(5)
4:16.357 stealthed Y shadowstrike Fluffy_Pillow 69.3/100: 69% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, vanish, subterfuge, symbols_of_death, finality_nightblade(5)
4:17.359 stealthed Y shadowstrike Fluffy_Pillow 71.3/100: 71% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, vanish, subterfuge, symbols_of_death, finality_nightblade(5)
4:18.362 finish M eviscerate Fluffy_Pillow 73.3/100: 73% energy | 6.0/6: 100% combo_points master_of_subtlety, symbols_of_death, finality_nightblade(5)
4:19.366 stealth_cds T sprint Fluffy_Pillow 89.3/100: 89% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(6), finality_nightblade(5)
4:19.366 stealth_cds V shadow_dance Fluffy_Pillow 89.3/100: 89% energy | 0.0/6: 0% combo_points master_of_subtlety, sprint, symbols_of_death, finality_eviscerate(6), finality_nightblade(5), faster_than_light_trigger
4:19.366 stealthed W symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, sprint, symbols_of_death, finality_eviscerate(6), finality_nightblade(5), faster_than_light_trigger
4:19.366 stealthed Y shadowstrike Fluffy_Pillow 65.0/100: 65% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, sprint, symbols_of_death, death, finality_eviscerate(6), finality_nightblade(5), faster_than_light_trigger
4:20.371 stealthed Y shadowstrike Fluffy_Pillow 42.0/100: 42% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, sprint, symbols_of_death, finality_eviscerate(6), finality_nightblade(5), faster_than_light_trigger
4:21.376 Waiting     1.045 sec 19.0/100: 19% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, shadow_dance, sprint, symbols_of_death, finality_eviscerate(6), finality_nightblade(5), faster_than_light_trigger
4:22.421 stealthed Y shadowstrike Fluffy_Pillow 55.5/100: 55% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, shadow_dance, vanish, subterfuge, sprint, symbols_of_death, finality_eviscerate(6), finality_nightblade(5)
4:23.426 Waiting     0.300 sec 32.5/100: 32% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, vanish, subterfuge, sprint, symbols_of_death, finality_eviscerate(6), finality_nightblade(5)
4:23.726 finish M eviscerate Fluffy_Pillow 35.8/100: 36% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, vanish, subterfuge, sprint, symbols_of_death, finality_eviscerate(6), finality_nightblade(5)
4:24.730 stealthed Y shadowstrike Fluffy_Pillow 51.8/100: 52% energy | 1.0/6: 17% combo_points master_of_subtlety, vanish, subterfuge, sprint, symbols_of_death, finality_nightblade(5)
4:25.735 build G backstab Fluffy_Pillow 53.8/100: 54% energy | 3.0/6: 50% combo_points master_of_subtlety, sprint, symbols_of_death, finality_nightblade(5)
4:26.739 Waiting     0.600 sec 29.8/100: 30% energy | 4.0/6: 67% combo_points master_of_subtlety, sprint, symbols_of_death, finality_nightblade(5)
4:27.339 finish L nightblade Fluffy_Pillow 36.3/100: 36% energy | 6.0/6: 100% combo_points master_of_subtlety, sprint, symbols_of_death, finality_nightblade(5)
4:28.344 build G backstab Fluffy_Pillow 62.4/100: 62% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death
4:29.349 Waiting     1.200 sec 38.4/100: 38% energy | 1.0/6: 17% combo_points master_of_subtlety, symbols_of_death
4:30.549 build G backstab Fluffy_Pillow 51.5/100: 52% energy | 1.0/6: 17% combo_points symbols_of_death
4:31.554 Waiting     0.900 sec 27.5/100: 28% energy | 2.0/6: 33% combo_points symbols_of_death
4:32.454 cds J shadow_blades Fluffy_Pillow 37.4/100: 37% energy | 3.0/6: 50% combo_points symbols_of_death
4:32.663 Waiting     1.100 sec 39.7/100: 40% energy | 3.0/6: 50% combo_points symbols_of_death, shadow_blades
4:33.763 build G backstab Fluffy_Pillow 51.7/100: 52% energy | 3.0/6: 50% combo_points symbols_of_death, shadow_blades
4:34.765 Waiting     0.700 sec 27.7/100: 28% energy | 5.0/6: 83% combo_points symbols_of_death, shadow_blades
4:35.465 finish M eviscerate Fluffy_Pillow 35.4/100: 35% energy | 5.0/6: 83% combo_points symbols_of_death, shadow_blades
4:36.470 stealth_cds V shadow_dance Fluffy_Pillow 51.4/100: 51% energy | 0.0/6: 0% combo_points symbols_of_death, shadow_blades, finality_eviscerate(5)
4:36.470 stealthed Y shadowstrike Fluffy_Pillow 76.4/100: 76% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(5)
4:37.476 stealthed Y shadowstrike Fluffy_Pillow 53.4/100: 53% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(5)
4:38.480 Waiting     0.500 sec 30.4/100: 30% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(5)
4:38.980 finish M eviscerate Fluffy_Pillow 35.9/100: 36% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(5)
4:39.985 stealthed Y shadowstrike Fluffy_Pillow 51.9/100: 52% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades
4:40.988 Waiting     2.100 sec 28.9/100: 29% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades
4:43.088 build G backstab Fluffy_Pillow 51.9/100: 52% energy | 4.0/6: 67% combo_points master_of_subtlety, symbols_of_death, shadow_blades
4:44.091 Waiting     0.700 sec 27.9/100: 28% energy | 6.0/6: 100% combo_points master_of_subtlety, symbols_of_death, shadow_blades
4:44.791 finish M eviscerate Fluffy_Pillow 35.5/100: 36% energy | 6.0/6: 100% combo_points master_of_subtlety, symbols_of_death, shadow_blades
4:45.796 stealth_cds V shadow_dance Fluffy_Pillow 91.5/100: 92% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6)
4:45.796 stealthed W symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6)
4:45.796 stealthed Y shadowstrike Fluffy_Pillow 65.0/100: 65% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, death, finality_eviscerate(6)
4:46.801 stealthed Y shadowstrike Fluffy_Pillow 42.0/100: 42% energy | 3.0/6: 50% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6)
4:47.806 Waiting     1.545 sec 19.0/100: 19% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6)
4:49.351 finish M eviscerate Fluffy_Pillow 35.9/100: 36% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6)
4:50.355 stealthed Y shadowstrike Fluffy_Pillow 51.9/100: 52% energy | 1.0/6: 17% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades
4:51.361 cds K goremaws_bite Fluffy_Pillow 54.0/100: 54% energy | 4.0/6: 67% combo_points master_of_subtlety, symbols_of_death, shadow_blades
4:52.365 finish M eviscerate Fluffy_Pillow 70.0/100: 70% energy | 6.0/6: 100% combo_points master_of_subtlety, symbols_of_death, shadow_blades, goremaws_bite
4:53.371 build G backstab Fluffy_Pillow 91.0/100: 91% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, shadow_blades, goremaws_bite, finality_eviscerate(6)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 8806 8481 0
Agility 32993 31287 20768 (13012)
Stamina 48391 48391 28183
Intellect 5325 5000 0
Spirit 0 0 0
Health 2903460 2903460 0
Energy 100 100 0
Combo Points 6 6 0
Crit 23.64% 23.64% 5456
Haste 9.55% 9.55% 3581
Damage / Heal Versatility 9.03% 8.23% 3909
Attack Power 32993 31287 0
Mastery 80.81% 80.81% 8510
Armor 2297 2297 2297
Run Speed 8 0 0

Gear

Source Slot Average Item Level: 891.00
Local Head Cowl of Fright
ilevel: 885, stats: { 300 Armor, +2829 Sta, +1886 AgiInt, +1015 Mastery, +547 Crit, +1076 unknown }
Local Neck Sea Fan Pendant
ilevel: 880, stats: { +1519 Sta, +1633 Vers, +965 Mastery }, enchant: mark_of_the_hidden_satyr
Local Shoulders Steelgazer Hide Mantle
ilevel: 880, stats: { 273 Armor, +1351 AgiInt, +2027 Sta, +673 Haste, +476 Vers, +771 unknown }
Local Shirt Common Gray Shirt
ilevel: 1
Local Chest Biornskin Vest
ilevel: 890, stats: { 376 Armor, +1977 AgiInt, +2965 Sta, +1034 Crit, +557 Mastery }
Local Waist Strand of Whelk Shells
ilevel: 880, stats: { 205 Armor, +2026 Sta, +1351 AgiInt, +673 Haste, +476 Mastery }, gems: { +150 Mastery }
Local Legs Legwraps of Unworthy Souls
ilevel: 880, stats: { 318 Armor, +2701 Sta, +1801 AgiInt, +964 Mastery, +570 Haste }
Local Feet Shadow Satyr's Walk
ilevel: 910, stats: { 276 Armor, +2680 Sta, +1786 Agi, +827 Haste, +459 Mastery }
Local Wrists Denial of the Half-Giants
ilevel: 910, stats: { 176 Armor, +2010 Sta, +1340 Agi, +276 Crit, +689 Mastery }
Local Hands Cruel Vice Grips
ilevel: 885, stats: { 231 Armor, +2122 Sta, +1415 AgiInt, +686 Crit, +485 Mastery }
Local Finger1 Grubby Silver Ring
ilevel: 880, stats: { +1519 Sta, +1484 Crit, +1114 Vers }, gems: { +150 Vers }, enchant: { +200 Mastery }
Local Finger2 Ring of Collapsing Futures
ilevel: 870, stats: { +1385 Sta, +1677 Mastery, +768 Haste, +419 Avoidance }, enchant: { +200 Vers }
Local Trinket1 Convergence of Fates
ilevel: 910, stats: { +2264 StrAgi }
Local Trinket2 Arcanogolem Digit
ilevel: 910, stats: { +2264 Agi }
Local Back Drape of the Mana-Starved
ilevel: 875, stats: { 142 Armor, +1450 Sta, +967 StrAgiInt, +586 Crit, +259 Vers }, gems: { +200 Agi }, enchant: { +200 Agi }
Local Main Hand Fangs of the Devourer
ilevel: 906, weapon: { 3844 - 7140, 1.8 }, stats: { +983 Agi, +1475 Sta, +368 Crit, +353 Mastery }, relics: { +53 ilevels, +51 ilevels, +52 ilevels }
Local Off Hand Fangs of the Devourer
ilevel: 906, weapon: { 3844 - 7140, 1.8 }, stats: { +983 Agi, +1475 Sta, +368 Crit, +353 Mastery }

Talents

Level
15 Master of Subtlety (Subtlety Rogue) Weaponmaster (Subtlety Rogue) Gloomblade (Subtlety Rogue)
30 Nightstalker Subterfuge Shadow Focus
45 Deeper Stratagem Anticipation Vigor
60 Soothing Darkness (Subtlety Rogue) Elusiveness Cheat Death
75 Strike from the Shadows (Subtlety Rogue) Prey on the Weak Tangled Shadow (Subtlety Rogue)
90 Premeditation (Subtlety Rogue) Alacrity Enveloping Shadows (Subtlety Rogue)
100 Master of Shadows (Subtlety Rogue) Marked for Death Death from Above

Profile

rogue="CoF+AD"
origin="https://eu.api.battle.net/wow/character/dalaran/Esdeåth/advanced"
level=110
race=human
role=attack
position=back
professions=alchemy=800/enchanting=133
talents=1210011
artifact=17:0:0:0:0:851:1:852:3:853:3:854:3:855:3:856:3:857:3:858:3:859:3:860:3:861:1:862:1:863:1:864:1:865:1:866:1:1349:1:1386:14
spec=subtlety

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,name=flask_of_the_seventh_demon
actions.precombat+=/augmentation,name=defiled
actions.precombat+=/food,name=seedbattered_fish_plate
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/stealth
actions.precombat+=/potion,name=old_war
actions.precombat+=/marked_for_death,if=raid_event.adds.in>40
# Defined variables that doesn't change during the fight
actions.precombat+=/variable,name=ssw_refund,value=equipped.shadow_satyrs_walk*(4+ssw_refund_offset)
actions.precombat+=/variable,name=stealth_threshold,value=(15+talent.vigor.enabled*35+talent.master_of_shadows.enabled*30+variable.ssw_refund)
actions.precombat+=/enveloping_shadows,if=combo_points>=5
actions.precombat+=/symbols_of_death

# Executed every time the actor is available.
actions=call_action_list,name=cds
# Fully switch to the Stealthed Rotation (by doing so, it forces pooling if nothing is available)
actions+=/run_action_list,name=stealthed,if=stealthed.all
actions+=/call_action_list,name=finish,if=combo_points>=5|(combo_points>=4&spell_targets.shuriken_storm>=3&spell_targets.shuriken_storm<=4)
actions+=/call_action_list,name=stealth_als,if=combo_points.deficit>=2+talent.premeditation.enabled
actions+=/call_action_list,name=build,if=energy.deficit<=variable.stealth_threshold

# Builders
actions.build=shuriken_storm,if=spell_targets.shuriken_storm>=2
actions.build+=/gloomblade
actions.build+=/backstab

# Cooldowns
actions.cds=potion,name=old_war,if=buff.bloodlust.react|target.time_to_die<=25|buff.shadow_blades.up
actions.cds+=/use_item,slot=finger2,if=(buff.shadow_blades.up&stealthed.rogue)|target.time_to_die<20
actions.cds+=/blood_fury,if=stealthed.rogue
actions.cds+=/berserking,if=stealthed.rogue
actions.cds+=/arcane_torrent,if=stealthed.rogue&energy.deficit>70
actions.cds+=/shadow_blades,if=combo_points<=2|(equipped.denial_of_the_halfgiants&combo_points>=1)
actions.cds+=/goremaws_bite,if=!stealthed.all&cooldown.shadow_dance.charges_fractional<=2.45&((combo_points.deficit>=4-(time<10)*2&energy.deficit>50+talent.vigor.enabled*25-(time>=10)*15)|target.time_to_die<8)
actions.cds+=/marked_for_death,target_if=min:target.time_to_die,if=target.time_to_die<combo_points.deficit|(raid_event.adds.in>40&combo_points.deficit>=4+talent.deeper_strategem.enabled+talent.anticipation.enabled)

# Finishers
actions.finish=enveloping_shadows,if=buff.enveloping_shadows.remains<target.time_to_die&buff.enveloping_shadows.remains<=combo_points*1.8
actions.finish+=/death_from_above,if=spell_targets.death_from_above>=6
actions.finish+=/nightblade,cycle_targets=1,if=target.time_to_die>8&((refreshable&(!finality|buff.finality_nightblade.up))|remains<tick_time)
actions.finish+=/death_from_above
actions.finish+=/eviscerate

# Stealth Action List Starter
actions.stealth_als=call_action_list,name=stealth_cds,if=energy.deficit<=variable.stealth_threshold&(!equipped.shadow_satyrs_walk|cooldown.shadow_dance.charges_fractional>=2.45|energy.deficit>=10)
actions.stealth_als+=/call_action_list,name=stealth_cds,if=spell_targets.shuriken_storm>=5
actions.stealth_als+=/call_action_list,name=stealth_cds,if=(cooldown.shadowmeld.up&!cooldown.vanish.up&cooldown.shadow_dance.charges<=1)
actions.stealth_als+=/call_action_list,name=stealth_cds,if=target.time_to_die<12*cooldown.shadow_dance.charges_fractional*(1+equipped.shadow_satyrs_walk*0.5)

# Stealth Cooldowns
actions.stealth_cds=shadow_dance,if=charges_fractional>=2.45
actions.stealth_cds+=/vanish
actions.stealth_cds+=/sprint_offensive
actions.stealth_cds+=/shadow_dance,if=charges>=2&combo_points<=1
actions.stealth_cds+=/pool_resource,for_next=1,extra_amount=40
actions.stealth_cds+=/shadowmeld,if=energy>=40&energy.deficit>=10+variable.ssw_refund
actions.stealth_cds+=/shadow_dance,if=combo_points<=1

# Stealthed Rotation
actions.stealthed=symbols_of_death,if=(buff.symbols_of_death.remains<target.time_to_die-4&buff.symbols_of_death.remains<=buff.symbols_of_death.duration*0.3)|equipped.shadow_satyrs_walk&energy.time_to_max<0.25
actions.stealthed+=/call_action_list,name=finish,if=combo_points>=5
actions.stealthed+=/shuriken_storm,if=buff.shadowmeld.down&((combo_points.deficit>=3&spell_targets.shuriken_storm>=2+talent.premeditation.enabled+equipped.shadow_satyrs_walk)|buff.the_dreadlords_deceit.stack>=29)
actions.stealthed+=/shadowstrike

head=cowl_of_fright,id=139205,bonus_id=1805/43/1507/3337
neck=sea_fan_pendant,id=142428,bonus_id=3507/1497,enchant=mark_of_the_hidden_satyr
shoulders=steelgazer_hide_mantle,id=134154,bonus_id=3417/43/1542/3337
back=drape_of_the_manastarved,id=141543,bonus_id=1808/1487/3337,gems=200agi,enchant=200agi
chest=biornskin_vest,id=134197,bonus_id=3417/1552/3337
shirt=common_gray_shirt,id=3428
wrists=denial_of_the_halfgiants,id=137100,bonus_id=3459/3458
hands=cruel_vice_grips,id=133617,bonus_id=3510/1537/3337
waist=strand_of_whelk_shells,id=142416,bonus_id=3507/1808/1497,gems=150mastery
legs=legwraps_of_unworthy_souls,id=133616,bonus_id=3418/1532/3337
feet=shadow_satyrs_walk,id=137032,bonus_id=3459/3458
finger1=grubby_silver_ring,id=139236,bonus_id=1806/1808/1502,gems=150vers,enchant=200mastery
finger2=ring_of_collapsing_futures,id=142173,bonus_id=40/3453/1482/3336,enchant=200vers
trinket1=convergence_of_fates,id=140806,bonus_id=3519
trinket2=arcanogolem_digit,id=140794,bonus_id=3519
main_hand=fangs_of_the_devourer,id=128476,bonus_id=743,gem_id=139267/142512/139253/0,relic_id=1806:1507:3336/3468:1492/1806:1502/0
off_hand=fangs_of_the_devourer,id=128479

# Gear Summary
# gear_ilvl=891.06
# gear_agility=20768
# gear_stamina=28183
# gear_crit_rating=5349
# gear_haste_rating=3511
# gear_mastery_rating=8343
# gear_versatility_rating=3832
# gear_avoidance_rating=419
# gear_armor=2297

CoF+DoS : 580632 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
580632.3 580632.3 538.7 / 0.093% 75485.7 / 13.0% 19656.3
RPS Out RPS In Primary Resource Waiting APM Active Skill
29.5 29.5 Energy 18.15% 59.0 100.0% 100%
Origin https://eu.api.battle.net/wow/character/dalaran/Esdeåth/advanced
Talents
  • 15: Master of Subtlety (Subtlety Rogue)
  • 30: Subterfuge
  • 45: Deeper Stratagem
  • 90: Premeditation (Subtlety Rogue)
  • 100: Master of Shadows (Subtlety Rogue)
  • Talent Calculator
Artifact
Professions
  • alchemy: 800
  • enchanting: 133

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
CoF+DoS 580632
auto_attack_mh 7194 1.2% 87.6 2.73sec 24832 16346 Direct 87.6 23719 47428 24832 23.7% 19.0%  

Stats details: auto_attack_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 87.60 87.60 0.00 0.00 1.5191 0.0000 2175325.07 3197933.91 31.98 16346.24 16346.24
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 50.26 57.37% 23718.73 18265 24110 23721.17 23146 24110 1192076 1752464 31.98
crit 20.73 23.67% 47428.29 36530 48220 47430.58 45395 48220 983249 1445469 31.98
miss 16.61 18.96% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_mh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
auto_attack_oh 3570 0.6% 87.1 2.74sec 12387 8108 Direct 87.1 11856 23716 12387 23.5% 19.1%  

Stats details: auto_attack_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 87.13 87.13 0.00 0.00 1.5278 0.0000 1079245.31 1586592.83 31.98 8107.74 8107.74
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 49.99 57.37% 11856.33 9133 12055 11857.57 11425 12055 592669 871280 31.98
crit 20.52 23.55% 23715.64 18265 24110 23717.76 22753 24110 486576 715313 31.98
miss 16.62 19.08% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_oh

Static Values
  • id:1
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Backstab 27001 4.7% 50.5 5.65sec 161499 160775 Direct 50.5 130482 260912 161500 23.8% 0.0%  

Stats details: backstab

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 50.51 50.51 0.00 0.00 1.0045 0.0000 8156940.73 11991475.52 31.98 160775.42 160775.42
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 38.50 76.22% 130482.13 101005 133327 130485.56 126509 132970 5023134 7384483 31.98
crit 12.01 23.78% 260911.69 202010 266653 260921.57 242412 266653 3133807 4606993 31.98
 
 

Action details: backstab

Static Values
  • id:53
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:53
  • name:Backstab
  • school:physical
  • tooltip:
  • description:Stab the target, causing ${$sw2*$<mult>} Physical damage. Damage increased by {$s4=30}% when you are behind your target. |cFFFFFFFFAwards {$s3=1} combo $lpoint:points;.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.70
 
Collapse 1882 0.3% 6.8 30.79sec 82296 0 Direct 6.8 66610 133233 82300 23.5% 0.0%  

Stats details: collapse

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.80 6.80 0.00 0.00 0.0000 0.0000 559641.84 559641.84 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.20 76.46% 66609.91 50574 66758 66159.69 0 66758 346321 346321 0.00
crit 1.60 23.54% 133232.73 101148 133516 100536.93 0 133516 213321 213321 0.00
 
 

Action details: collapse

Static Values
  • id:234142
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:15.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:234142
  • name:Collapse
  • school:shadow
  • tooltip:
  • description:Deal {$s1=40000} Shadow damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:40000.00
  • base_dd_max:40000.00
 
Eviscerate 172356 29.7% 57.2 5.18sec 906442 902392 Direct 57.2 654315 1307422 906430 38.6% 0.0%  

Stats details: eviscerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 57.17 57.17 0.00 0.00 1.0045 0.0000 51818045.37 76177435.03 31.98 902391.82 902391.82
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 35.10 61.40% 654314.78 401033 787693 654479.96 609680 700485 22965089 33760856 31.98
crit 22.07 38.60% 1307422.19 802066 1575386 1307730.68 1183383 1429444 28852956 42416579 31.98
 
 

Action details: eviscerate

Static Values
  • id:196819
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.15
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:196819
  • name:Eviscerate
  • school:physical
  • tooltip:
  • description:Finishing move that disembowels the target, causing damage per combo point. 1 point : ${$m1*1} damage 2 points: ${$m1*2} damage 3 points: ${$m1*3} damage 4 points: ${$m1*4} damage 5 points: ${$m1*5} damage{$?s193531=false}[ 6 points: ${$m1*6} damage][]
Weapon
  • normalized:false
  • weapon_power_mod:0.000000
  • weapon_multiplier:0.00
 
Fel-Crazed Rage 48374 8.3% 47.4 5.81sec 306530 0 Direct 47.4 248143 496276 306602 23.6% 0.0%  

Stats details: felcrazed_rage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.44 47.42 0.00 0.00 0.0000 0.0000 14540316.21 14540316.21 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 36.25 76.44% 248143.13 188967 249436 248185.99 221721 249436 8995150 8995150 0.00
crit 11.17 23.56% 496276.35 377933 498872 496346.65 438403 498872 5545167 5545167 0.00
 
 

Action details: felcrazed_rage

Static Values
  • id:225777
  • school:shadow
  • resource:none
  • range:8.0
  • travel_speed:30.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:225777
  • name:Fel-Crazed Rage
  • school:shadow
  • tooltip:
  • description:{$@spelldesc225141=Enter a fel-crazed rage, dealing {$225777s1=53264 to 58870} Shadow damage to a random nearby enemy every ${$t1}.2 sec for {$d=3 seconds}. You cannot move or use abilities during your rage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:141984.15
  • base_dd_max:156929.85
 
Goremaw's Bite 0 (9375) 0.0% (1.6%) 4.6 63.96sec 612776 610039

Stats details: goremaws_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.61 0.00 0.00 0.00 1.0045 0.0000 0.00 0.00 0.00 610038.57 610038.57
 
 

Action details: goremaws_bite

Static Values
  • id:209782
  • school:shadow
  • resource:none
  • range:8.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!stealthed.all&cooldown.shadow_dance.charges_fractional<=2.45&((combo_points.deficit>=4-(time<10)*2&energy.deficit>50+talent.vigor.enabled*25-(time>=10)*15)|target.time_to_die<8)
Spelldata
  • id:209782
  • name:Goremaw's Bite
  • school:physical
  • tooltip:
  • description:Lashes out at the target, inflicting ${$209783sw2+$209784sw2} Shadow damage and reducing movement speed by {$209786s1=60}% for {$209786d=8 seconds}. Grants $220901o2 Energy over {$220901d=6 seconds}. |cFFFFFFFFAwards {$220901s1=3} combo $lpoint:points;.|r
 
    Goremaw's Bite (_mh) 6260 1.1% 4.6 63.96sec 409195 0 Direct 4.6 330187 660552 409199 23.9% 0.0%  

Stats details: goremaws_bite_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.61 4.61 0.00 0.00 0.0000 0.0000 1885704.47 1885704.47 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 3.51 76.09% 330186.99 257468 339858 328998.91 0 339858 1157770 1157770 0.00
crit 1.10 23.91% 660551.86 514937 679717 470007.54 0 679717 727935 727935 0.00
 
 

Action details: goremaws_bite_mh

Static Values
  • id:209783
  • school:shadow
  • resource:none
  • range:8.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:209783
  • name:Goremaw's Bite
  • school:shadow
  • tooltip:
  • description:{$@spelldesc209782=Lashes out at the target, inflicting ${$209783sw2+$209784sw2} Shadow damage and reducing movement speed by {$209786s1=60}% for {$209786d=8 seconds}. Grants $220901o2 Energy over {$220901d=6 seconds}. |cFFFFFFFFAwards {$220901s1=3} combo $lpoint:points;.|r}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:10.00
 
    Goremaw's Bite (_oh) 3115 0.5% 4.6 63.96sec 203580 0 Direct 4.6 165125 330140 203589 23.3% 0.0%  

Stats details: goremaws_bite_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.61 4.61 0.00 0.00 0.0000 0.0000 938164.05 938164.05 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 3.53 76.70% 165125.04 128741 169938 164854.85 0 169938 583648 583648 0.00
crit 1.07 23.30% 330140.24 257481 339875 229488.37 0 339875 354516 354516 0.00
 
 

Action details: goremaws_bite_oh

Static Values
  • id:209784
  • school:shadow
  • resource:none
  • range:8.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:209784
  • name:Goremaw's Bite
  • school:shadow
  • tooltip:
  • description:{$@spelldesc209782=Lashes out at the target, inflicting ${$209783sw2+$209784sw2} Shadow damage and reducing movement speed by {$209786s1=60}% for {$209786d=8 seconds}. Grants $220901o2 Energy over {$220901d=6 seconds}. |cFFFFFFFFAwards {$220901s1=3} combo $lpoint:points;.|r}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:10.00
 
Mark of the Hidden Satyr 8384 1.4% 16.8 17.45sec 149889 0 Direct 16.8 121342 242677 149886 23.5% 0.0%  

Stats details: mark_of_the_hidden_satyr

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.84 16.84 0.00 0.00 0.0000 0.0000 2524750.92 2524750.92 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 12.88 76.47% 121341.94 93052 122828 121354.72 115849 122828 1563019 1563019 0.00
crit 3.96 23.53% 242676.83 186103 245656 238476.42 0 245656 961732 961732 0.00
 
 

Action details: mark_of_the_hidden_satyr

Static Values
  • id:191259
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191259
  • name:Mark of the Hidden Satyr
  • school:fire
  • tooltip:
  • description:Deals fire damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:2.500000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Nightblade 110501 19.1% 16.9 17.49sec 1966820 1958051 Periodic 144.1 187036 374015 231091 23.6% 0.0% 95.7%

Stats details: nightblade

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.93 0.00 144.09 144.09 1.0045 2.0000 33298620.77 33298620.77 0.00 109106.41 1958051.32
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 110.1 76.44% 187035.67 127142 208112 187045.94 181899 191826 20601265 20601265 0.00
crit 33.9 23.56% 374014.59 254285 416223 374052.03 346648 398742 12697355 12697355 0.00
 
 

Action details: nightblade

Static Values
  • id:195452
  • school:shadow
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:25.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:target.time_to_die>8&((refreshable&(!finality|buff.finality_nightblade.up))|remains<tick_time)
Spelldata
  • id:195452
  • name:Nightblade
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec and snared by attacks.
  • description:Finishing move that infects the target with shadowy energy, dealing Shadow damage over time and causing attacks against the target to reduce movement speed by {$206760s1=30}% for {$206760d=8 seconds}. Lasts longer per combo point. 1 point : ${$m1*8/2} over 8 sec 2 points: ${$m1*10/2} over 10 sec 3 points: ${$m1*12/2} over 12 sec 4 points: ${$m1*14/2} over 14 sec 5 points: ${$m1*16/2} over 16 sec{$?s193531=false}[ 6 points: ${$m1*18/2} over 18 sec][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:1.380000
  • spell_power_mod.tick:0.000000
  • base_td:1.00
  • dot_duration:6.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Potion of the Old War 17664 3.0% 22.1 5.61sec 236605 0 Direct 22.1 191261 382570 236600 23.7% 0.0%  

Stats details: potion_of_the_old_war

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.07 22.07 0.00 0.00 0.0000 0.0000 5221076.55 7675477.08 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.84 76.30% 191261.41 146122 192882 191263.82 177945 192882 3220195 4733991 31.98
crit 5.23 23.70% 382570.07 292245 385763 380638.17 0 385763 2000882 2941486 31.82
 
 

Action details: potion_of_the_old_war

Static Values
  • id:188028
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188028
  • name:Potion of the Old War
  • school:physical
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:135920.00
  • base_dd_max:203880.00
 
Shadow Blades 0 (22012) 0.0% (3.8%) 3.5 98.43sec 1868220 0

Stats details: shadow_blades

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.54 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: shadow_blades

Static Values
  • id:121471
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:combo_points<=2|(equipped.denial_of_the_halfgiants&combo_points>=1)
Spelldata
  • id:121471
  • name:Shadow Blades
  • school:physical
  • tooltip:Autoattacks deal pure Shadow damage. Combo-point-generating attacks generate {$s2=1} additional combo point.
  • description:Draws upon surrounding shadows to empower your weapons, causing auto attacks to deal Shadow damage and abilities that generate combo points to generate 1 additional combo point. Lasts {$d=15 seconds}.
 
    Shadow Blade (_mh) 14676 2.5% 101.6 2.79sec 43365 29942 Direct 101.6 35075 70151 43365 23.6% 0.0%  

Stats details: shadow_blade_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 101.57 101.57 0.00 0.00 1.4483 0.0000 4404511.04 4404511.04 0.00 29942.29 29942.29
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 77.56 76.36% 35074.81 26852 35444 35075.20 34370 35444 2720428 2720428 0.00
crit 24.01 23.64% 70150.84 53703 70888 70149.29 67666 70888 1684084 1684084 0.00
 
 

Action details: shadow_blade_mh

Static Values
  • id:121473
  • school:shadow
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:121473
  • name:Shadow Blade
  • school:shadow
  • tooltip:
  • description:Strike with dark energy, dealing Shadow damage equal to {$s1=1}% weapon damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
    Shadow Blade Off-hand 7336 1.3% 101.6 2.79sec 21678 14968 Direct 101.6 17537 35077 21678 23.6% 0.0%  

Stats details: shadow_blade_offhand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 101.57 101.57 0.00 0.00 1.4483 0.0000 2201714.57 2201714.57 0.00 14967.67 14967.67
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 77.59 76.39% 17537.16 13426 17722 17537.38 17194 17722 1360683 1360683 0.00
crit 23.98 23.61% 35076.95 26852 35444 35077.92 33974 35444 841031 841031 0.00
 
 

Action details: shadow_blade_offhand

Static Values
  • id:121474
  • school:shadow
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:121474
  • name:Shadow Blade Off-hand
  • school:shadow
  • tooltip:
  • description:Strike with dark energy, dealing Shadow damage equal to {$s1=1}% weapon damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Shadow Nova 10317 1.8% 32.7 9.22sec 94749 0 Direct 32.7 76641 153285 94748 23.6% 0.0%  

Stats details: shadow_nova

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 32.74 32.74 0.00 0.00 0.0000 0.0000 3102114.97 3102114.97 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 25.01 76.37% 76641.40 63871 76645 76641.36 75662 76645 1916434 1916434 0.00
crit 7.74 23.63% 153284.92 127741 153290 153254.91 0 153290 1185681 1185681 0.00
 
 

Action details: shadow_nova

Static Values
  • id:197800
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:5.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:197800
  • name:Shadow Nova
  • school:shadow
  • tooltip:
  • description:Deals {$s1=0} Shadow damage to enemies with $A1 yards.
 
Shadowstrike 115781 (142003) 19.9% (24.4%) 105.4 2.82sec 404817 403006 Direct 105.4 246294 492601 330048 34.0% 0.0%  

Stats details: shadowstrike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 105.42 105.42 0.00 0.00 1.0045 0.0000 34793586.61 51149868.06 31.98 403006.34 403006.34
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 69.57 65.99% 246294.11 205255 246306 246294.30 244227 246306 17134659 25189572 31.98
crit 35.85 34.01% 492600.58 410510 492612 492600.18 487636 492612 17658927 25960296 31.98
 
 

Action details: shadowstrike

Static Values
  • id:185438
  • school:physical
  • resource:energy
  • range:15.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:185438
  • name:Shadowstrike
  • school:physical
  • tooltip:
  • description:Strike through the shadows, $?a231718[appearing behind your target and ][]dealing $sw2 Physical damage. |cFFFFFFFFAwards {$s3=1} combo $lpoint:points;.|r
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:8.50
 
    Soul Rip 26222 4.5% 104.8 2.82sec 75232 0 Direct 104.8 60831 121661 75233 23.7% 0.0%  

Stats details: soul_rip

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 104.76 104.76 0.00 0.00 0.0000 0.0000 7881560.34 7881560.34 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 79.96 76.33% 60830.51 60831 60831 60830.51 60831 60831 4864080 4864080 0.00
crit 24.80 23.67% 121661.02 121661 121661 121661.02 121661 121661 3017480 3017480 0.00
 
 

Action details: soul_rip

Static Values
  • id:220893
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:220893
  • name:Soul Rip
  • school:shadow
  • tooltip:
  • description:{$@spelldesc209835=After using Shadowstrike or Cheap Shot, Akaari's Soul appears $m1 sec later and Soul Rips your target, dealing {$220893s1=1} Shadow damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:1.500000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Simple Action Stats Execute Interval
CoF+DoS
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:CoF+DoS
  • harmful:false
  • if_expr:
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:CoF+DoS
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:CoF+DoS
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Shadow Dance 27.4 10.92sec

Stats details: shadow_dance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 27.42 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: shadow_dance

Static Values
  • id:185313
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:charges_fractional>=2.45
Spelldata
  • id:185313
  • name:Shadow Dance
  • school:physical
  • tooltip:
  • description:Allows use of all Stealth abilities and grants all the combat benefits of Stealth for {$d=3 seconds}. Effect not broken from taking damage or attacking. {$?s14062=false}[Movement speed while active is increased by {$1784s3=0}% and damage dealt is increased by {$1784s4=0}%. ]?s108209[Abilities cost {$112942s1=75}% less while active. ][]{$?s31223=false}[Attacks from Shadow Dance and for {$31223s1=5} sec after deal {$31665s1=10}% more damage. ][]
 
Sprint 2.7 122.37sec

Stats details: sprint

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.71 0.00 85.79 0.00 0.0000 0.2500 0.00 0.00 0.00 0.00 0.00
 
 

Action details: sprint

Static Values
  • id:2983
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:2983
  • name:Sprint
  • school:physical
  • tooltip:Movement speed increased by $w1%.
  • description:Increases your movement speed by {$s1=70}% for {$d=8 seconds}. Usable while stealthed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:0.25
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Symbols of Death 14.5 21.71sec

Stats details: symbols_of_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.52 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: symbols_of_death

Static Values
  • id:212283
  • school:physical
  • resource:energy
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:10.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:212283
  • name:Symbols of Death
  • school:physical
  • tooltip:All damage done increased by {$s1=20}%.
  • description:Invoke ancient symbols of power, increasing all damage you deal by {$s1=20}% for {$d=35 seconds}, and causing your next Shadowstrike to critically strike. Unaffected by the global cooldown.
 
Vanish 2.8 122.58sec

Stats details: vanish

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.80 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: vanish

Static Values
  • id:1856
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:1856
  • name:Vanish
  • school:physical
  • tooltip:Improved stealth.
  • description:Allows you to vanish from sight, entering stealth while in combat. For the first {$11327d=3 seconds} after vanishing, damage and harmful effects received will not break stealth. Also breaks movement impairing effects.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 33.34% 0.0(0.0) 1.0

Buff details

  • buff initial source:CoF+DoS
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Death 14.5 0.0 21.0sec 21.7sec 2.02% 13.67% 0.0(0.0) 0.1

Buff details

  • buff initial source:CoF+DoS
  • cooldown name:buff_death
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • death_1:2.02%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:227151
  • name:Death
  • tooltip:Your next Shadowstrike will critically strike.
  • description:{$@spelldesc212283=Invoke ancient symbols of power, increasing all damage you deal by {$s1=20}% for {$d=35 seconds}, and causing your next Shadowstrike to critically strike. Unaffected by the global cooldown.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Faster Than Light Trigger 2.7 0.0 122.4sec 122.4sec 2.69% 2.69% 0.0(0.0) 2.7

Buff details

  • buff initial source:CoF+DoS
  • cooldown name:buff_faster_than_light_trigger
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • faster_than_light_trigger_1:2.69%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:197270
  • name:Faster Than Light Trigger
  • tooltip:
  • description:
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
Finality: Eviscerate 28.8 0.0 10.4sec 10.4sec 48.35% 49.56% 0.0(0.0) 0.0

Buff details

  • buff initial source:CoF+DoS
  • cooldown name:buff_finality_eviscerate
  • max_stacks:10
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.04

Stack Uptimes

  • finality_eviscerate_5:19.94%
  • finality_eviscerate_6:28.41%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:197496
  • name:Finality: Eviscerate
  • tooltip:Your next Eviscerate will do $w1% increased damage.
  • description:
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Finality: Nightblade 8.7 0.0 35.2sec 35.2sec 42.61% 41.17% 0.0(0.0) 0.0

Buff details

  • buff initial source:CoF+DoS
  • cooldown name:buff_finality_nightblade
  • max_stacks:6
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.04

Stack Uptimes

  • finality_nightblade_5:14.81%
  • finality_nightblade_6:27.79%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:197498
  • name:Finality: Nightblade
  • tooltip:Your next Nightblade will do $w1% increased damage.
  • description:
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Goremaw's Bite 4.6 0.0 64.0sec 64.0sec 9.06% 9.06% 27.3(27.3) 4.5

Buff details

  • buff initial source:CoF+DoS
  • cooldown name:buff_goremaws_bite
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • goremaws_bite_1:9.06%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:220901
  • name:Goremaw's Bite
  • tooltip:Generating {$s2=5} Energy every $t2 sec.
  • description:{$@spelldesc209782=Lashes out at the target, inflicting ${$209783sw2+$209784sw2} Shadow damage and reducing movement speed by {$209786s1=60}% for {$209786d=8 seconds}. Grants $220901o2 Energy over {$220901d=6 seconds}. |cFFFFFFFFAwards {$220901s1=3} combo $lpoint:points;.|r}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Master of Subtlety 37.8 1.5 8.0sec 7.6sec 34.70% 48.05% 1.5(1.5) 12.2

Buff details

  • buff initial source:CoF+DoS
  • cooldown name:buff_master_of_subtlety
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • master_of_subtlety_1:34.70%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:31223
  • name:Master of Subtlety
  • tooltip:
  • description:Attacks made while stealthed and for {$s1=5} seconds after breaking stealth cause an additional {$31665s1=10}% damage.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Master of Subtlety (_aura) 37.8 1.5 8.0sec 7.7sec 51.06% 35.41% 1.5(1.5) 0.0

Buff details

  • buff initial source:CoF+DoS
  • cooldown name:buff_master_of_subtlety_aura
  • max_stacks:1
  • duration:150.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • master_of_subtlety_aura_1:51.06%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:31223
  • name:Master of Subtlety
  • tooltip:
  • description:Attacks made while stealthed and for {$s1=5} seconds after breaking stealth cause an additional {$31665s1=10}% damage.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of the Old War 2.0 0.0 97.7sec 0.0sec 16.24% 16.24% 0.0(0.0) 2.0

Buff details

  • buff initial source:CoF+DoS
  • cooldown name:buff_potion_of_the_old_war
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_the_old_war_1:16.24%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188028
  • name:Potion of the Old War
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Shadow Blades 3.5 0.0 98.2sec 98.4sec 53.21% 56.07% 0.0(0.0) 3.2

Buff details

  • buff initial source:CoF+DoS
  • cooldown name:buff_shadow_blades
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • shadow_blades_1:53.21%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:121471
  • name:Shadow Blades
  • tooltip:Autoattacks deal pure Shadow damage. Combo-point-generating attacks generate {$s2=1} additional combo point.
  • description:Draws upon surrounding shadows to empower your weapons, causing auto attacks to deal Shadow damage and abilities that generate combo points to generate 1 additional combo point. Lasts {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Shadow Dance 27.4 0.0 10.9sec 10.9sec 45.26% 45.26% 0.0(0.0) 27.0

Buff details

  • buff initial source:CoF+DoS
  • cooldown name:buff_shadow_dance
  • max_stacks:1
  • duration:5.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • shadow_dance_1:45.26%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:185313
  • name:Shadow Dance
  • tooltip:
  • description:Allows use of all Stealth abilities and grants all the combat benefits of Stealth for {$d=3 seconds}. Effect not broken from taking damage or attacking. {$?s14062=false}[Movement speed while active is increased by {$1784s3=0}% and damage dealt is increased by {$1784s4=0}%. ]?s108209[Abilities cost {$112942s1=75}% less while active. ][]{$?s31223=false}[Attacks from Shadow Dance and for {$31223s1=5} sec after deal {$31665s1=10}% more damage. ][]
  • max_stacks:0
  • duration:3.00
  • cooldown:1.00
  • default_chance:0.00%
Sprint 2.7 0.0 122.4sec 122.4sec 7.11% 7.11% 85.8(85.8) 2.7

Buff details

  • buff initial source:CoF+DoS
  • cooldown name:buff_sprint
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • sprint_1:7.11%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2983
  • name:Sprint
  • tooltip:Movement speed increased by $w1%.
  • description:Increases your movement speed by {$s1=70}% for {$d=8 seconds}. Usable while stealthed.
  • max_stacks:0
  • duration:8.00
  • cooldown:120.00
  • default_chance:0.00%
Stealth 6.4 0.0 45.5sec 51.8sec 2.04% 2.04% 0.0(0.0) 0.0

Buff details

  • buff initial source:CoF+DoS
  • cooldown name:buff_stealth
  • max_stacks:1
  • duration:150.00
  • cooldown:2.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stealth_1:2.04%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:1784
  • name:Stealth
  • tooltip:Stealthed.$?$w3!=0[ Movement speed increased by $w3%.][]$?$w4!=0[ Damage increased by $w4%.][]
  • description:Conceals you in the shadows until cancelled, allowing you to stalk enemies without being seen. {$?s14062=false}[Movement speed while stealthed is increased by {$s3=0}% and damage dealt is increased by {$s4=0}%.]?s108209[ Abilities cost {$112942s1=75}% less while stealthed. ][]{$?s31223=false}[ Attacks from Stealth and for {$31223s1=5} sec after deal {$31665s1=10}% more damage.][]
  • max_stacks:0
  • duration:-0.00
  • cooldown:2.00
  • default_chance:100.00%
Subterfuge 6.5 0.0 44.6sec 44.6sec 6.47% 6.47% 0.0(0.0) 6.4

Buff details

  • buff initial source:CoF+DoS
  • cooldown name:buff_subterfuge
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • subterfuge_1:6.47%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:115192
  • name:Subterfuge
  • tooltip:Temporarily concealed in the shadows.
  • description:{$@spelldesc108208=Your abilities requiring Stealth can still be used for {$115192d=3 seconds} after Stealth breaks.$?c3[ Also increases the duration of Shadow Dance by ${$m2/1000} sec.][ Also causes Garrote to deal {$115192s2=125}% increased damage and have no cooldown when used from Stealth or {$115192d=3 seconds} after Stealth breaks.]}
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
Symbols of Death 1.2 13.4 188.7sec 21.7sec 99.83% 99.33% 13.4(13.4) 0.2

Buff details

  • buff initial source:CoF+DoS
  • cooldown name:buff_symbols_of_death
  • max_stacks:1
  • duration:35.00
  • cooldown:10.00
  • default_chance:100.00%
  • default_value:1.20

Stack Uptimes

  • symbols_of_death_1:99.83%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:212283
  • name:Symbols of Death
  • tooltip:All damage done increased by {$s1=20}%.
  • description:Invoke ancient symbols of power, increasing all damage you deal by {$s1=20}% for {$d=35 seconds}, and causing your next Shadowstrike to critically strike. Unaffected by the global cooldown.
  • max_stacks:0
  • duration:35.00
  • cooldown:10.00
  • default_chance:0.00%
Temptation 2.1 4.7 116.6sec 30.9sec 44.19% 67.31% 0.0(0.0) 1.8

Buff details

  • buff initial source:CoF+DoS
  • cooldown name:buff_temptation
  • max_stacks:10
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • temptation_1:11.30%
  • temptation_2:12.14%
  • temptation_3:12.74%
  • temptation_4:7.84%
  • temptation_5:0.11%
  • temptation_6:0.03%
  • temptation_7:0.04%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:234143
  • name:Temptation
  • tooltip:Increased chance for your Ring of Collapsing Futures to incur a {$s1=5} min cooldown.
  • description:{$@spelldesc234142=Deal {$s1=40000} Shadow damage to an enemy.}
  • max_stacks:10
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Vanish 5.5 0.0 51.8sec 51.8sec 5.45% 5.45% 0.0(0.0) 5.4

Buff details

  • buff initial source:CoF+DoS
  • cooldown name:buff_vanish
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • vanish_1:5.45%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:11327
  • name:Vanish
  • tooltip:Improved stealth.$?$w3!=0[ Movement speed increased by $w3%.][]$?$w4!=0[ Damage increased by $w4%.][]
  • description:
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:CoF+DoS
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Seventh Demon

Buff details

  • buff initial source:CoF+DoS
  • cooldown name:buff_flask_of_the_seventh_demon
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:1300.00

Stack Uptimes

  • flask_of_the_seventh_demon_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188033
  • name:Flask of the Seventh Demon
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (seedbattered_fish_plate)

Buff details

  • buff initial source:CoF+DoS
  • cooldown name:buff_seedbattered_fish_plate
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:versatility_rating
  • amount:375.00

Stack Uptimes

  • seedbattered_fish_plate_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225605
  • name:Well Fed
  • tooltip:Versatility increased by $w1.
  • description:Increases versatility by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
CoF+DoS
backstab Energy 50.5 1767.7 35.0 35.0 4614.3
eviscerate Energy 57.2 2000.8 35.0 35.0 25899.3
eviscerate Combo Points 57.2 321.5 5.6 5.6 161153.3
nightblade Energy 16.9 423.3 25.0 25.0 78672.5
nightblade Combo Points 16.9 95.2 5.6 5.6 349677.5
shadowstrike Energy 105.4 4216.6 40.0 40.0 10120.7
symbols_of_death Energy 14.5 473.1 32.6 32.6 0.0
Resource Gains Type Count Total Average Overflow
backstab Combo Points 50.51 50.51 (12.04%) 1.00 0.00 0.00%
goremaws_bite Combo Points 4.61 13.59 (3.24%) 2.95 0.23 1.68%
shadowstrike Combo Points 105.42 210.83 (50.24%) 2.00 0.00 0.00%
energy_regen Energy 1096.23 3344.48 (37.90%) 3.05 188.03 5.32%
Shadow Techniques Combo Points 76.19 72.97 (17.39%) 0.96 18.45 20.18%
Master of Shadows Energy 38.38 786.99 (8.92%) 20.50 172.54 17.98%
Shadow Blades Combo Points 84.72 71.76 (17.10%) 0.85 12.96 15.30%
Energetic Stabbing Energy 26.37 659.28 (7.47%) 25.00 0.00 0.00%
Goremaw's Bite Energy 27.26 128.21 (1.45%) 4.70 8.08 5.93%
Relentless Strikes Energy 74.09 3273.59 (37.09%) 44.18 60.72 1.82%
Shadow Satyr's Walk Energy 105.42 632.50 (7.17%) 6.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Energy 29.29 29.48
Combo Points 1.39 1.38
Combat End Resource Mean Min Max
Energy 43.12 6.04 100.00
Combo Points 2.93 0.00 6.00

Benefits & Uptimes

Benefits %
Uptimes %
Energy Cap 3.7%

Statistics & Data Analysis

Fight Length
Sample Data CoF+DoS Fight Length
Count 4999
Mean 301.28
Minimum 222.03
Maximum 381.32
Spread ( max - min ) 159.29
Range [ ( max - min ) / 2 * 100% ] 26.44%
DPS
Sample Data CoF+DoS Damage Per Second
Count 4999
Mean 580632.29
Minimum 513184.07
Maximum 647963.45
Spread ( max - min ) 134779.38
Range [ ( max - min ) / 2 * 100% ] 11.61%
Standard Deviation 19434.8163
5th Percentile 549447.00
95th Percentile 613206.46
( 95th Percentile - 5th Percentile ) 63759.47
Mean Distribution
Standard Deviation 274.8773
95.00% Confidence Intervall ( 580093.54 - 581171.04 )
Normalized 95.00% Confidence Intervall ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 44
0.1% Error 4304
0.1 Scale Factor Error with Delta=300 3224368
0.05 Scale Factor Error with Delta=300 12897471
0.01 Scale Factor Error with Delta=300 322436762
Priority Target DPS
Sample Data CoF+DoS Priority Target Damage Per Second
Count 4999
Mean 580632.29
Minimum 513184.07
Maximum 647963.45
Spread ( max - min ) 134779.38
Range [ ( max - min ) / 2 * 100% ] 11.61%
Standard Deviation 19434.8163
5th Percentile 549447.00
95th Percentile 613206.46
( 95th Percentile - 5th Percentile ) 63759.47
Mean Distribution
Standard Deviation 274.8773
95.00% Confidence Intervall ( 580093.54 - 581171.04 )
Normalized 95.00% Confidence Intervall ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 44
0.1% Error 4304
0.1 Scale Factor Error with Delta=300 3224368
0.05 Scale Factor Error with Delta=300 12897471
0.01 Scale Factor Error with Delta=300 322436762
DPS(e)
Sample Data CoF+DoS Damage Per Second (Effective)
Count 4999
Mean 580632.29
Minimum 513184.07
Maximum 647963.45
Spread ( max - min ) 134779.38
Range [ ( max - min ) / 2 * 100% ] 11.61%
Damage
Sample Data CoF+DoS Damage
Count 4999
Mean 174581318.81
Minimum 125839129.91
Maximum 225186794.21
Spread ( max - min ) 99347664.30
Range [ ( max - min ) / 2 * 100% ] 28.45%
DTPS
Sample Data CoF+DoS Damage Taken Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data CoF+DoS Healing Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data CoF+DoS Healing Per Second (Effective)
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data CoF+DoS Heal
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data CoF+DoS Healing Taken Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data CoF+DoS Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data CoF+DoSTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data CoF+DoS Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,name=flask_of_the_seventh_demon
1 0.00 augmentation,name=defiled
2 0.00 food,name=seedbattered_fish_plate
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 stealth
5 0.00 potion,name=old_war
6 0.00 marked_for_death,if=raid_event.adds.in>40
7 0.00 variable,name=ssw_refund,value=equipped.shadow_satyrs_walk*(4+ssw_refund_offset)
Defined variables that doesn't change during the fight
8 0.00 variable,name=stealth_threshold,value=(15+talent.vigor.enabled*35+talent.master_of_shadows.enabled*30+variable.ssw_refund)
9 0.00 enveloping_shadows,if=combo_points>=5
A 0.00 symbols_of_death
Default action list Executed every time the actor is available.
# count action,conditions
B 0.00 call_action_list,name=cds
C 0.00 run_action_list,name=stealthed,if=stealthed.all
Fully switch to the Stealthed Rotation (by doing so, it forces pooling if nothing is available)
D 0.00 call_action_list,name=finish,if=combo_points>=5|(combo_points>=4&spell_targets.shuriken_storm>=3&spell_targets.shuriken_storm<=4)
E 0.00 call_action_list,name=stealth_als,if=combo_points.deficit>=2+talent.premeditation.enabled
F 0.00 call_action_list,name=build,if=energy.deficit<=variable.stealth_threshold
actions.build Builders
# count action,conditions
0.00 shuriken_storm,if=spell_targets.shuriken_storm>=2
0.00 gloomblade
G 50.51 backstab
actions.cds Cooldowns
# count action,conditions
H 1.00 potion,name=old_war,if=buff.bloodlust.react|target.time_to_die<=25|buff.shadow_blades.up
I 6.80 use_item,slot=finger2,if=(buff.shadow_blades.up&stealthed.rogue)|target.time_to_die<20
J 3.67 use_item,slot=trinket2,if=(buff.shadow_blades.up&stealthed.rogue)|target.time_to_die<20
0.00 blood_fury,if=stealthed.rogue
0.00 berserking,if=stealthed.rogue
0.00 arcane_torrent,if=stealthed.rogue&energy.deficit>70
K 3.54 shadow_blades,if=combo_points<=2|(equipped.denial_of_the_halfgiants&combo_points>=1)
L 4.61 goremaws_bite,if=!stealthed.all&cooldown.shadow_dance.charges_fractional<=2.45&((combo_points.deficit>=4-(time<10)*2&energy.deficit>50+talent.vigor.enabled*25-(time>=10)*15)|target.time_to_die<8)
0.00 marked_for_death,target_if=min:target.time_to_die,if=target.time_to_die<combo_points.deficit|(raid_event.adds.in>40&combo_points.deficit>=4+talent.deeper_strategem.enabled+talent.anticipation.enabled)
actions.finish Finishers
# count action,conditions
0.00 enveloping_shadows,if=buff.enveloping_shadows.remains<target.time_to_die&buff.enveloping_shadows.remains<=combo_points*1.8
0.00 death_from_above,if=spell_targets.death_from_above>=6
M 16.93 nightblade,cycle_targets=1,if=target.time_to_die>8&((refreshable&(!finality|buff.finality_nightblade.up))|remains<tick_time)
0.00 death_from_above
N 57.16 eviscerate
actions.stealth_cds Stealth Cooldowns
# count action,conditions
S 3.79 shadow_dance,if=charges_fractional>=2.45
T 2.81 vanish
U 2.71 sprint_offensive
V 4.29 shadow_dance,if=charges>=2&combo_points<=1
0.00 pool_resource,for_next=1,extra_amount=40
0.00 shadowmeld,if=energy>=40&energy.deficit>=10+variable.ssw_refund
W 19.34 shadow_dance,if=combo_points<=1
actions.stealthed Stealthed Rotation
# count action,conditions
X 13.52 symbols_of_death,if=(buff.symbols_of_death.remains<target.time_to_die-4&buff.symbols_of_death.remains<=buff.symbols_of_death.duration*0.3)|equipped.shadow_satyrs_walk&energy.time_to_max<0.25
Y 0.00 call_action_list,name=finish,if=combo_points>=5
0.00 shuriken_storm,if=buff.shadowmeld.down&((combo_points.deficit>=3&spell_targets.shuriken_storm>=2+talent.premeditation.enabled+equipped.shadow_satyrs_walk)|buff.the_dreadlords_deceit.stack>=29)
Z 105.42 shadowstrike

Sample Sequence

0124578AKIJZZMSZZNZZNTXZZNSIZZNZMGUGNVXZZNZNGGNVIZZNXZZNGGMVZZNZZNVIZZNZNLGMVXZZNZZNVZZZNZGNWZZMZZNWZZNZGGMWXZZKHIJNGGNWZZMXZZNGGNLGNWIZZMZZNWZZNXZNGGNTIZZNWXZZNZZMUWZZNZZNGGGGMWZZZNZGGNWZZZNZGGMLGNWXZZNZZNGGGKMWJXZNGGNGGMWZZNZZNGGNWXZZMZGNWZZNZZNGLNWXZZNZZMGGTZZNWXZZNZGUGMZZGNWZZNZZNJGGGNWZZZNZG

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask CoF+DoS 100.0/100: 100% energy | 0.0/6: 0% combo_points
Pre precombat 1 augmentation CoF+DoS 100.0/100: 100% energy | 0.0/6: 0% combo_points
Pre precombat 2 food CoF+DoS 100.0/100: 100% energy | 0.0/6: 0% combo_points
Pre precombat 4 stealth Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, stealth
Pre precombat 5 potion Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, stealth, potion_of_the_old_war
Pre precombat 7 ssw_refund Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, stealth, potion_of_the_old_war
Pre precombat 8 stealth_threshold Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, stealth, potion_of_the_old_war
Pre precombat A symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, stealth, symbols_of_death, death, potion_of_the_old_war
0:00.000 cds K shadow_blades Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, stealth, symbols_of_death, death, potion_of_the_old_war
0:00.000 cds I use_item_ring_of_collapsing_futures Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, stealth, symbols_of_death, shadow_blades, death, potion_of_the_old_war
0:00.000 cds J use_item_draught_of_souls Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points temptation, master_of_subtlety_aura, stealth, symbols_of_death, shadow_blades, death, potion_of_the_old_war
0:03.000 stealthed Z shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points bloodlust, temptation, master_of_subtlety_aura, stealth, symbols_of_death, shadow_blades, death, potion_of_the_old_war
0:04.006 stealthed Z shadowstrike Fluffy_Pillow 80.8/100: 81% energy | 3.0/6: 50% combo_points bloodlust, temptation, master_of_subtlety_aura, stealth, subterfuge, symbols_of_death, shadow_blades, potion_of_the_old_war
0:05.012 finish M nightblade Fluffy_Pillow 61.5/100: 62% energy | 6.0/6: 100% combo_points bloodlust, temptation, master_of_subtlety_aura, stealth, subterfuge, symbols_of_death, shadow_blades, potion_of_the_old_war
0:06.015 stealth_cds S shadow_dance Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points bloodlust, temptation, master_of_subtlety, symbols_of_death, shadow_blades, finality_nightblade(6), potion_of_the_old_war
0:06.015 stealthed Z shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points bloodlust, temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6), potion_of_the_old_war
0:07.019 stealthed Z shadowstrike Fluffy_Pillow 80.7/100: 81% energy | 4.0/6: 67% combo_points bloodlust, temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6), potion_of_the_old_war
0:08.022 finish N eviscerate Fluffy_Pillow 61.5/100: 61% energy | 6.0/6: 100% combo_points bloodlust, temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6), potion_of_the_old_war
0:09.027 stealthed Z shadowstrike Fluffy_Pillow 81.2/100: 81% energy | 0.0/6: 0% combo_points bloodlust, temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6), potion_of_the_old_war
0:10.031 stealthed Z shadowstrike Fluffy_Pillow 61.9/100: 62% energy | 3.0/6: 50% combo_points bloodlust, temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6), potion_of_the_old_war
0:11.036 finish N eviscerate Fluffy_Pillow 67.7/100: 68% energy | 6.0/6: 100% combo_points bloodlust, temptation, master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6), potion_of_the_old_war
0:12.038 stealth_cds T vanish Fluffy_Pillow 87.4/100: 87% energy | 1.0/6: 17% combo_points bloodlust, temptation, master_of_subtlety, symbols_of_death, shadow_blades, finality_nightblade(6), potion_of_the_old_war
0:12.038 stealthed X symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points bloodlust, temptation, master_of_subtlety_aura, vanish, symbols_of_death, shadow_blades, finality_nightblade(6), potion_of_the_old_war
0:12.038 stealthed Z shadowstrike Fluffy_Pillow 65.0/100: 65% energy | 1.0/6: 17% combo_points bloodlust, temptation, master_of_subtlety_aura, vanish, symbols_of_death, shadow_blades, death, finality_nightblade(6), potion_of_the_old_war
0:13.042 stealthed Z shadowstrike Fluffy_Pillow 70.7/100: 71% energy | 4.0/6: 67% combo_points bloodlust, temptation, master_of_subtlety_aura, vanish, subterfuge, symbols_of_death, shadow_blades, finality_nightblade(6), potion_of_the_old_war
0:14.045 finish N eviscerate Fluffy_Pillow 51.5/100: 51% energy | 6.0/6: 100% combo_points bloodlust, temptation, master_of_subtlety_aura, vanish, subterfuge, symbols_of_death, shadow_blades, finality_nightblade(6), potion_of_the_old_war
0:15.050 stealth_cds S shadow_dance Fluffy_Pillow 96.2/100: 96% energy | 1.0/6: 17% combo_points bloodlust, temptation, master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6), potion_of_the_old_war
0:15.050 cds I use_item_ring_of_collapsing_futures Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points bloodlust, temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6), potion_of_the_old_war
0:15.050 stealthed Z shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points bloodlust, temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6), potion_of_the_old_war
0:16.055 stealthed Z shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 4.0/6: 67% combo_points bloodlust, temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6), potion_of_the_old_war
0:17.059 finish N eviscerate Fluffy_Pillow 100.0/100: 100% energy | 6.0/6: 100% combo_points bloodlust, temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6), potion_of_the_old_war
0:18.064 stealthed Z shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points bloodlust, temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6), potion_of_the_old_war
0:19.068 finish M nightblade Fluffy_Pillow 100.0/100: 100% energy | 5.0/6: 83% combo_points bloodlust, temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6), potion_of_the_old_war
0:20.073 build G backstab Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points bloodlust, temptation(2), master_of_subtlety, symbols_of_death, shadow_blades, potion_of_the_old_war
0:21.076 stealth_cds U sprint Fluffy_Pillow 79.7/100: 80% energy | 3.0/6: 50% combo_points bloodlust, temptation(2), master_of_subtlety, symbols_of_death, shadow_blades, potion_of_the_old_war
0:21.076 build G backstab Fluffy_Pillow 79.7/100: 80% energy | 3.0/6: 50% combo_points bloodlust, temptation(2), master_of_subtlety, sprint, symbols_of_death, shadow_blades, faster_than_light_trigger, potion_of_the_old_war
0:22.080 finish N eviscerate Fluffy_Pillow 59.5/100: 59% energy | 5.0/6: 83% combo_points bloodlust, temptation(2), master_of_subtlety, sprint, symbols_of_death, shadow_blades, faster_than_light_trigger, potion_of_the_old_war
0:23.083 stealth_cds V shadow_dance Fluffy_Pillow 79.2/100: 79% energy | 0.0/6: 0% combo_points bloodlust, temptation(2), master_of_subtlety, sprint, symbols_of_death, shadow_blades, finality_eviscerate(5), faster_than_light_trigger
0:23.083 stealthed X symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points bloodlust, temptation(2), master_of_subtlety_aura, shadow_dance, sprint, symbols_of_death, shadow_blades, finality_eviscerate(5), faster_than_light_trigger
0:23.083 stealthed Z shadowstrike Fluffy_Pillow 65.0/100: 65% energy | 0.0/6: 0% combo_points bloodlust, temptation(2), master_of_subtlety_aura, shadow_dance, sprint, symbols_of_death, shadow_blades, death, finality_eviscerate(5), faster_than_light_trigger
0:24.087 stealthed Z shadowstrike Fluffy_Pillow 95.7/100: 96% energy | 3.0/6: 50% combo_points bloodlust, temptation(2), master_of_subtlety_aura, shadow_dance, vanish, subterfuge, sprint, symbols_of_death, shadow_blades, finality_eviscerate(5)
0:25.092 finish N eviscerate Fluffy_Pillow 76.5/100: 76% energy | 6.0/6: 100% combo_points bloodlust, temptation(2), master_of_subtlety_aura, shadow_dance, vanish, subterfuge, sprint, symbols_of_death, shadow_blades, finality_eviscerate(5)
0:26.096 stealthed Z shadowstrike Fluffy_Pillow 96.2/100: 96% energy | 2.0/6: 33% combo_points bloodlust, temptation(2), master_of_subtlety_aura, shadow_dance, vanish, subterfuge, sprint, symbols_of_death, shadow_blades
0:27.101 finish N eviscerate Fluffy_Pillow 100.0/100: 100% energy | 5.0/6: 83% combo_points bloodlust, temptation(2), master_of_subtlety, shadow_dance, sprint, symbols_of_death, shadow_blades
0:28.104 build G backstab Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points bloodlust, temptation(2), master_of_subtlety, sprint, symbols_of_death, shadow_blades, finality_eviscerate(5)
0:29.110 build G backstab Fluffy_Pillow 79.8/100: 80% energy | 3.0/6: 50% combo_points bloodlust, temptation(2), master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(5)
0:30.114 finish N eviscerate Fluffy_Pillow 59.5/100: 59% energy | 5.0/6: 83% combo_points bloodlust, temptation(2), master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(5)
0:31.118 stealth_cds V shadow_dance Fluffy_Pillow 79.2/100: 79% energy | 0.0/6: 0% combo_points bloodlust, temptation(2), master_of_subtlety, symbols_of_death, shadow_blades
0:31.118 cds I use_item_ring_of_collapsing_futures Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points bloodlust, temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades
0:31.118 stealthed Z shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points bloodlust, temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades
0:32.121 stealthed Z shadowstrike Fluffy_Pillow 80.7/100: 81% energy | 4.0/6: 67% combo_points bloodlust, temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades
0:33.126 finish N eviscerate Fluffy_Pillow 86.5/100: 86% energy | 6.0/6: 100% combo_points bloodlust, temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades
0:34.131 stealthed X symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points bloodlust, temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6)
0:34.131 stealthed Z shadowstrike Fluffy_Pillow 65.0/100: 65% energy | 1.0/6: 17% combo_points bloodlust, temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, death, finality_eviscerate(6)
0:35.136 stealthed Z shadowstrike Fluffy_Pillow 70.7/100: 71% energy | 4.0/6: 67% combo_points bloodlust, temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6)
0:36.140 finish N eviscerate Fluffy_Pillow 76.5/100: 76% energy | 6.0/6: 100% combo_points bloodlust, temptation(3), master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6)
0:37.145 build G backstab Fluffy_Pillow 96.2/100: 96% energy | 1.0/6: 17% combo_points bloodlust, temptation(3), master_of_subtlety, symbols_of_death, shadow_blades
0:38.150 build G backstab Fluffy_Pillow 76.0/100: 76% energy | 3.0/6: 50% combo_points bloodlust, temptation(3), master_of_subtlety, symbols_of_death, shadow_blades
0:39.154 finish M nightblade Fluffy_Pillow 55.7/100: 56% energy | 5.0/6: 83% combo_points bloodlust, temptation(3), master_of_subtlety, symbols_of_death, shadow_blades
0:40.159 stealth_cds V shadow_dance Fluffy_Pillow 85.5/100: 85% energy | 1.0/6: 17% combo_points bloodlust, temptation(3), master_of_subtlety, symbols_of_death, shadow_blades, finality_nightblade(5)
0:40.159 stealthed Z shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points bloodlust, temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(5)
0:41.165 stealthed Z shadowstrike Fluffy_Pillow 77.4/100: 77% energy | 4.0/6: 67% combo_points temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(5)
0:42.170 finish N eviscerate Fluffy_Pillow 54.7/100: 55% energy | 6.0/6: 100% combo_points temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(5)
0:43.174 stealthed Z shadowstrike Fluffy_Pillow 71.0/100: 71% energy | 1.0/6: 17% combo_points temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(5)
0:44.178 stealthed Z shadowstrike Fluffy_Pillow 48.4/100: 48% energy | 4.0/6: 67% combo_points temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(5)
0:45.183 finish N eviscerate Fluffy_Pillow 50.7/100: 51% energy | 6.0/6: 100% combo_points temptation(3), master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(5)
0:46.186 stealth_cds V shadow_dance Fluffy_Pillow 67.0/100: 67% energy | 1.0/6: 17% combo_points temptation(3), master_of_subtlety, symbols_of_death, shadow_blades, finality_nightblade(5)
0:46.186 cds I use_item_ring_of_collapsing_futures Fluffy_Pillow 92.0/100: 92% energy | 1.0/6: 17% combo_points temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(5)
0:46.186 stealthed Z shadowstrike Fluffy_Pillow 92.0/100: 92% energy | 1.0/6: 17% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(5)
0:47.190 stealthed Z shadowstrike Fluffy_Pillow 69.4/100: 69% energy | 4.0/6: 67% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(5)
0:48.193 finish N eviscerate Fluffy_Pillow 46.7/100: 47% energy | 6.0/6: 100% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(5)
0:49.197 stealthed Z shadowstrike Fluffy_Pillow 63.0/100: 63% energy | 0.0/6: 0% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(5)
0:50.202 finish N eviscerate Fluffy_Pillow 40.4/100: 40% energy | 5.0/6: 83% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(5)
0:51.206 cds L goremaws_bite Fluffy_Pillow 56.7/100: 57% energy | 0.0/6: 0% combo_points temptation(4), master_of_subtlety, symbols_of_death, shadow_blades, finality_nightblade(5)
0:52.212 build G backstab Fluffy_Pillow 73.1/100: 73% energy | 3.0/6: 50% combo_points temptation(4), master_of_subtlety, symbols_of_death, shadow_blades, goremaws_bite, finality_nightblade(5)
0:53.216 finish M nightblade Fluffy_Pillow 54.4/100: 54% energy | 6.0/6: 100% combo_points temptation(4), master_of_subtlety, symbols_of_death, shadow_blades, goremaws_bite, finality_nightblade(5)
0:54.221 stealth_cds V shadow_dance Fluffy_Pillow 85.7/100: 86% energy | 0.0/6: 0% combo_points temptation(4), master_of_subtlety, symbols_of_death, shadow_blades, goremaws_bite
0:54.221 stealthed X symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, goremaws_bite
0:54.221 stealthed Z shadowstrike Fluffy_Pillow 65.0/100: 65% energy | 0.0/6: 0% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, goremaws_bite, death
0:55.226 stealthed Z shadowstrike Fluffy_Pillow 47.3/100: 47% energy | 3.0/6: 50% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, goremaws_bite
0:56.232 finish N eviscerate Fluffy_Pillow 54.7/100: 55% energy | 6.0/6: 100% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death, goremaws_bite
0:57.237 stealthed Z shadowstrike Fluffy_Pillow 76.0/100: 76% energy | 0.0/6: 0% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6)
0:58.241 stealthed Z shadowstrike Fluffy_Pillow 53.4/100: 53% energy | 2.0/6: 33% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6)
0:59.247 Waiting     1.200 sec 30.7/100: 31% energy | 4.0/6: 67% combo_points temptation(4), master_of_subtlety, symbols_of_death, finality_eviscerate(6)
1:00.447 finish N eviscerate Fluffy_Pillow 44.3/100: 44% energy | 5.0/6: 83% combo_points temptation(4), master_of_subtlety, symbols_of_death, finality_eviscerate(6)
1:01.452 stealth_cds V shadow_dance Fluffy_Pillow 60.6/100: 61% energy | 0.0/6: 0% combo_points temptation(4), master_of_subtlety, symbols_of_death
1:01.452 stealthed Z shadowstrike Fluffy_Pillow 85.6/100: 86% energy | 0.0/6: 0% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death
1:02.458 stealthed Z shadowstrike Fluffy_Pillow 63.0/100: 63% energy | 2.0/6: 33% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death
1:03.463 stealthed Z shadowstrike Fluffy_Pillow 40.3/100: 40% energy | 4.0/6: 67% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death
1:04.467 finish N eviscerate Fluffy_Pillow 42.7/100: 43% energy | 6.0/6: 100% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death
1:05.471 stealthed Z shadowstrike Fluffy_Pillow 59.0/100: 59% energy | 0.0/6: 0% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6)
1:06.476 Waiting     1.300 sec 36.3/100: 36% energy | 2.0/6: 33% combo_points temptation(4), master_of_subtlety, symbols_of_death, finality_eviscerate(6)
1:07.776 build G backstab Fluffy_Pillow 51.0/100: 51% energy | 2.0/6: 33% combo_points temptation(4), master_of_subtlety, symbols_of_death, finality_eviscerate(6)
1:08.781 Waiting     0.700 sec 27.4/100: 27% energy | 5.0/6: 83% combo_points temptation(4), master_of_subtlety, symbols_of_death, finality_eviscerate(6)
1:09.481 finish N eviscerate Fluffy_Pillow 35.3/100: 35% energy | 5.0/6: 83% combo_points temptation(4), master_of_subtlety, symbols_of_death, finality_eviscerate(6)
1:10.486 stealth_cds W shadow_dance Fluffy_Pillow 51.6/100: 52% energy | 0.0/6: 0% combo_points temptation(4), master_of_subtlety, symbols_of_death
1:10.486 stealthed Z shadowstrike Fluffy_Pillow 76.6/100: 77% energy | 0.0/6: 0% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death
1:11.491 stealthed Z shadowstrike Fluffy_Pillow 53.9/100: 54% energy | 2.0/6: 33% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death
1:12.493 finish M nightblade Fluffy_Pillow 31.3/100: 31% energy | 5.0/6: 83% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death
1:13.497 stealthed Z shadowstrike Fluffy_Pillow 57.6/100: 58% energy | 0.0/6: 0% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(5)
1:14.502 Waiting     0.500 sec 34.9/100: 35% energy | 2.0/6: 33% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(5)
1:15.002 stealthed Z shadowstrike Fluffy_Pillow 40.6/100: 41% energy | 2.0/6: 33% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(5)
1:16.008 Waiting     1.525 sec 17.9/100: 18% energy | 4.0/6: 67% combo_points temptation(4), master_of_subtlety, symbols_of_death, finality_nightblade(5)
1:17.533 finish N eviscerate Fluffy_Pillow 35.2/100: 35% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death, finality_nightblade(5)
1:18.538 stealth_cds W shadow_dance Fluffy_Pillow 51.5/100: 51% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5), finality_nightblade(5)
1:18.538 stealthed Z shadowstrike Fluffy_Pillow 76.5/100: 76% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5), finality_nightblade(5)
1:19.541 stealthed Z shadowstrike Fluffy_Pillow 53.8/100: 54% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5), finality_nightblade(5)
1:20.546 Waiting     0.700 sec 31.2/100: 31% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5), finality_nightblade(5)
1:21.246 finish N eviscerate Fluffy_Pillow 39.1/100: 39% energy | 5.0/6: 83% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5), finality_nightblade(5)
1:22.248 stealthed Z shadowstrike Fluffy_Pillow 55.4/100: 55% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(5)
1:23.252 Waiting     1.700 sec 32.7/100: 33% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(5)
1:24.952 build G backstab Fluffy_Pillow 51.9/100: 52% energy | 2.0/6: 33% combo_points master_of_subtlety, symbols_of_death, finality_nightblade(5)
1:25.955 Waiting     2.100 sec 28.2/100: 28% energy | 4.0/6: 67% combo_points master_of_subtlety, symbols_of_death, finality_nightblade(5)
1:28.055 build G backstab Fluffy_Pillow 51.9/100: 52% energy | 4.0/6: 67% combo_points master_of_subtlety, symbols_of_death, finality_nightblade(5)
1:29.061 finish M nightblade Fluffy_Pillow 28.3/100: 28% energy | 5.0/6: 83% combo_points symbols_of_death, finality_nightblade(5)
1:30.068 stealth_cds W shadow_dance Fluffy_Pillow 54.7/100: 55% energy | 0.0/6: 0% combo_points symbols_of_death
1:30.068 stealthed X symbols_of_death Fluffy_Pillow 79.7/100: 80% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
1:30.068 stealthed Z shadowstrike Fluffy_Pillow 44.7/100: 45% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, death
1:31.071 Waiting     1.668 sec 22.0/100: 22% energy | 3.0/6: 50% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
1:32.739 stealthed Z shadowstrike Fluffy_Pillow 40.8/100: 41% energy | 3.0/6: 50% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
1:33.744 Waiting     1.007 sec 18.1/100: 18% energy | 5.0/6: 83% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
1:34.751 cds K shadow_blades Fluffy_Pillow 29.5/100: 30% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
1:35.000 cds H potion Fluffy_Pillow 32.3/100: 32% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades
1:35.000 cds I use_item_ring_of_collapsing_futures Fluffy_Pillow 32.3/100: 32% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, potion_of_the_old_war
1:35.000 cds J use_item_draught_of_souls Fluffy_Pillow 32.3/100: 32% energy | 6.0/6: 100% combo_points temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, potion_of_the_old_war
1:38.000 finish N eviscerate Fluffy_Pillow 66.2/100: 66% energy | 6.0/6: 100% combo_points temptation, master_of_subtlety, symbols_of_death, shadow_blades, potion_of_the_old_war
1:39.007 build G backstab Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points temptation, master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), potion_of_the_old_war
1:40.011 build G backstab Fluffy_Pillow 76.3/100: 76% energy | 2.0/6: 33% combo_points temptation, master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), potion_of_the_old_war
1:41.015 finish N eviscerate Fluffy_Pillow 52.7/100: 53% energy | 5.0/6: 83% combo_points temptation, symbols_of_death, shadow_blades, finality_eviscerate(6), potion_of_the_old_war
1:42.021 stealth_cds W shadow_dance Fluffy_Pillow 69.0/100: 69% energy | 0.0/6: 0% combo_points temptation, symbols_of_death, shadow_blades, potion_of_the_old_war
1:42.051 stealthed Z shadowstrike Fluffy_Pillow 94.4/100: 94% energy | 0.0/6: 0% combo_points temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, potion_of_the_old_war
1:43.056 stealthed Z shadowstrike Fluffy_Pillow 71.7/100: 72% energy | 3.0/6: 50% combo_points temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, potion_of_the_old_war
1:44.059 finish M nightblade Fluffy_Pillow 49.0/100: 49% energy | 6.0/6: 100% combo_points temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, potion_of_the_old_war
1:45.066 stealthed X symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6), potion_of_the_old_war
1:45.066 stealthed Z shadowstrike Fluffy_Pillow 65.0/100: 65% energy | 0.0/6: 0% combo_points temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, death, finality_nightblade(6), potion_of_the_old_war
1:46.070 stealthed Z shadowstrike Fluffy_Pillow 67.3/100: 67% energy | 3.0/6: 50% combo_points temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6), potion_of_the_old_war
1:47.075 finish N eviscerate Fluffy_Pillow 44.7/100: 45% energy | 6.0/6: 100% combo_points temptation, master_of_subtlety, symbols_of_death, shadow_blades, finality_nightblade(6), potion_of_the_old_war
1:48.080 build G backstab Fluffy_Pillow 61.0/100: 61% energy | 0.0/6: 0% combo_points temptation, master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6), potion_of_the_old_war
1:49.084 Waiting     1.300 sec 37.4/100: 37% energy | 4.0/6: 67% combo_points temptation, master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6), potion_of_the_old_war
1:50.384 build G backstab Fluffy_Pillow 52.0/100: 52% energy | 4.0/6: 67% combo_points temptation, master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6), potion_of_the_old_war
1:51.387 Waiting     0.600 sec 28.4/100: 28% energy | 6.0/6: 100% combo_points temptation, master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6), potion_of_the_old_war
1:51.987 finish N eviscerate Fluffy_Pillow 35.1/100: 35% energy | 6.0/6: 100% combo_points temptation, master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6), potion_of_the_old_war
1:52.991 cds L goremaws_bite Fluffy_Pillow 51.5/100: 51% energy | 0.0/6: 0% combo_points temptation, symbols_of_death, shadow_blades, finality_nightblade(6), potion_of_the_old_war
1:53.997 build G backstab Fluffy_Pillow 67.8/100: 68% energy | 3.0/6: 50% combo_points temptation, symbols_of_death, shadow_blades, goremaws_bite, finality_nightblade(6), potion_of_the_old_war
1:55.002 finish N eviscerate Fluffy_Pillow 49.2/100: 49% energy | 5.0/6: 83% combo_points temptation, symbols_of_death, shadow_blades, goremaws_bite, finality_nightblade(6), potion_of_the_old_war
1:56.006 stealth_cds W shadow_dance Fluffy_Pillow 70.5/100: 70% energy | 0.0/6: 0% combo_points temptation, symbols_of_death, shadow_blades, goremaws_bite, finality_eviscerate(5), finality_nightblade(6), potion_of_the_old_war
1:56.006 cds I use_item_ring_of_collapsing_futures Fluffy_Pillow 95.5/100: 95% energy | 0.0/6: 0% combo_points temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, goremaws_bite, finality_eviscerate(5), finality_nightblade(6), potion_of_the_old_war
1:56.006 stealthed Z shadowstrike Fluffy_Pillow 95.5/100: 95% energy | 0.0/6: 0% combo_points temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, goremaws_bite, finality_eviscerate(5), finality_nightblade(6), potion_of_the_old_war
1:57.011 stealthed Z shadowstrike Fluffy_Pillow 77.8/100: 78% energy | 4.0/6: 67% combo_points temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, goremaws_bite, finality_eviscerate(5), finality_nightblade(6), potion_of_the_old_war
1:58.016 finish M nightblade Fluffy_Pillow 60.2/100: 60% energy | 6.0/6: 100% combo_points temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, goremaws_bite, finality_eviscerate(5), finality_nightblade(6), potion_of_the_old_war
1:59.021 stealthed Z shadowstrike Fluffy_Pillow 91.5/100: 92% energy | 0.0/6: 0% combo_points temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(5), potion_of_the_old_war
2:00.026 stealthed Z shadowstrike Fluffy_Pillow 68.9/100: 69% energy | 4.0/6: 67% combo_points temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(5)
2:01.030 finish N eviscerate Fluffy_Pillow 46.2/100: 46% energy | 6.0/6: 100% combo_points temptation(2), master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(5)
2:02.036 stealth_cds W shadow_dance Fluffy_Pillow 62.6/100: 63% energy | 0.0/6: 0% combo_points temptation(2), master_of_subtlety, symbols_of_death, shadow_blades
2:02.036 stealthed Z shadowstrike Fluffy_Pillow 87.6/100: 88% energy | 0.0/6: 0% combo_points temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades
2:03.041 stealthed Z shadowstrike Fluffy_Pillow 89.9/100: 90% energy | 4.0/6: 67% combo_points temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades
2:04.047 finish N eviscerate Fluffy_Pillow 92.3/100: 92% energy | 6.0/6: 100% combo_points temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades
2:05.053 stealthed X symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6)
2:05.053 stealthed Z shadowstrike Fluffy_Pillow 65.0/100: 65% energy | 0.0/6: 0% combo_points temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, death, finality_eviscerate(6)
2:06.058 finish N eviscerate Fluffy_Pillow 42.3/100: 42% energy | 5.0/6: 83% combo_points temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6)
2:07.062 build G backstab Fluffy_Pillow 58.7/100: 59% energy | 0.0/6: 0% combo_points temptation(2), master_of_subtlety, symbols_of_death, shadow_blades
2:08.066 Waiting     1.500 sec 35.0/100: 35% energy | 2.0/6: 33% combo_points temptation(2), master_of_subtlety, symbols_of_death, shadow_blades
2:09.566 build G backstab Fluffy_Pillow 51.9/100: 52% energy | 2.0/6: 33% combo_points temptation(2), master_of_subtlety, symbols_of_death, shadow_blades
2:10.573 Waiting     0.600 sec 28.3/100: 28% energy | 4.0/6: 67% combo_points temptation(2), master_of_subtlety, symbols_of_death, shadow_blades
2:11.173 finish N eviscerate Fluffy_Pillow 35.1/100: 35% energy | 5.0/6: 83% combo_points temptation(2), master_of_subtlety, symbols_of_death, shadow_blades
2:12.177 stealth_cds T vanish Fluffy_Pillow 51.4/100: 51% energy | 0.0/6: 0% combo_points temptation(2), symbols_of_death, shadow_blades, finality_eviscerate(5)
2:12.177 cds I use_item_ring_of_collapsing_futures Fluffy_Pillow 76.4/100: 76% energy | 0.0/6: 0% combo_points temptation(2), master_of_subtlety_aura, vanish, symbols_of_death, shadow_blades, finality_eviscerate(5)
2:12.177 stealthed Z shadowstrike Fluffy_Pillow 76.4/100: 76% energy | 0.0/6: 0% combo_points temptation(3), master_of_subtlety_aura, vanish, symbols_of_death, shadow_blades, finality_eviscerate(5)
2:13.183 stealthed Z shadowstrike Fluffy_Pillow 53.8/100: 54% energy | 3.0/6: 50% combo_points temptation(3), master_of_subtlety_aura, vanish, subterfuge, symbols_of_death, shadow_blades, finality_eviscerate(5)
2:14.188 finish N eviscerate Fluffy_Pillow 56.1/100: 56% energy | 6.0/6: 100% combo_points temptation(3), master_of_subtlety_aura, vanish, subterfuge, symbols_of_death, shadow_blades, finality_eviscerate(5)
2:15.194 stealth_cds W shadow_dance Fluffy_Pillow 97.5/100: 97% energy | 0.0/6: 0% combo_points temptation(3), master_of_subtlety, symbols_of_death, shadow_blades
2:15.194 stealthed X symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades
2:15.194 stealthed Z shadowstrike Fluffy_Pillow 65.0/100: 65% energy | 0.0/6: 0% combo_points temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, death
2:16.201 stealthed Z shadowstrike Fluffy_Pillow 42.4/100: 42% energy | 3.0/6: 50% combo_points temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades
2:17.208 finish N eviscerate Fluffy_Pillow 44.7/100: 45% energy | 6.0/6: 100% combo_points temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades
2:18.213 stealthed Z shadowstrike Fluffy_Pillow 61.1/100: 61% energy | 0.0/6: 0% combo_points temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6)
2:19.217 stealthed Z shadowstrike Fluffy_Pillow 63.4/100: 63% energy | 3.0/6: 50% combo_points temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6)
2:20.221 finish M nightblade Fluffy_Pillow 65.7/100: 66% energy | 6.0/6: 100% combo_points temptation(3), master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6)
2:21.226 stealth_cds U sprint Fluffy_Pillow 92.1/100: 92% energy | 0.0/6: 0% combo_points temptation(3), master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6)
2:21.226 stealth_cds W shadow_dance Fluffy_Pillow 92.1/100: 92% energy | 0.0/6: 0% combo_points temptation(3), master_of_subtlety, sprint, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6), faster_than_light_trigger
2:21.226 stealthed Z shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points temptation(3), master_of_subtlety_aura, shadow_dance, sprint, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6), faster_than_light_trigger
2:22.231 stealthed Z shadowstrike Fluffy_Pillow 77.3/100: 77% energy | 3.0/6: 50% combo_points temptation(3), master_of_subtlety_aura, shadow_dance, sprint, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6), faster_than_light_trigger
2:23.237 finish N eviscerate Fluffy_Pillow 54.7/100: 55% energy | 6.0/6: 100% combo_points temptation(3), master_of_subtlety_aura, shadow_dance, sprint, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6), faster_than_light_trigger
2:24.241 stealthed Z shadowstrike Fluffy_Pillow 96.0/100: 96% energy | 0.0/6: 0% combo_points temptation(3), master_of_subtlety_aura, shadow_dance, vanish, subterfuge, sprint, symbols_of_death, shadow_blades, finality_nightblade(6)
2:25.246 stealthed Z shadowstrike Fluffy_Pillow 73.4/100: 73% energy | 3.0/6: 50% combo_points temptation(3), master_of_subtlety_aura, shadow_dance, vanish, subterfuge, sprint, symbols_of_death, shadow_blades, finality_nightblade(6)
2:26.250 finish N eviscerate Fluffy_Pillow 50.7/100: 51% energy | 6.0/6: 100% combo_points temptation(3), master_of_subtlety, vanish, subterfuge, sprint, symbols_of_death, finality_nightblade(6)
2:27.254 build G backstab Fluffy_Pillow 92.0/100: 92% energy | 0.0/6: 0% combo_points temptation(3), master_of_subtlety, sprint, symbols_of_death, finality_eviscerate(6), finality_nightblade(6)
2:28.259 build G backstab Fluffy_Pillow 68.4/100: 68% energy | 1.0/6: 17% combo_points temptation(3), master_of_subtlety, sprint, symbols_of_death, finality_eviscerate(6), finality_nightblade(6)
2:29.264 Waiting     0.600 sec 44.7/100: 45% energy | 2.0/6: 33% combo_points temptation(3), master_of_subtlety, symbols_of_death, finality_eviscerate(6), finality_nightblade(6)
2:29.864 build G backstab Fluffy_Pillow 51.5/100: 52% energy | 2.0/6: 33% combo_points temptation(3), master_of_subtlety, symbols_of_death, finality_eviscerate(6), finality_nightblade(6)
2:30.867 Waiting     2.100 sec 27.8/100: 28% energy | 4.0/6: 67% combo_points temptation(3), master_of_subtlety, symbols_of_death, finality_eviscerate(6), finality_nightblade(6)
2:32.967 build G backstab Fluffy_Pillow 51.5/100: 52% energy | 4.0/6: 67% combo_points temptation(3), symbols_of_death, finality_eviscerate(6), finality_nightblade(6)
2:33.971 finish M nightblade Fluffy_Pillow 27.9/100: 28% energy | 6.0/6: 100% combo_points temptation(3), symbols_of_death, finality_eviscerate(6), finality_nightblade(6)
2:34.977 stealth_cds W shadow_dance Fluffy_Pillow 54.2/100: 54% energy | 0.0/6: 0% combo_points temptation(3), symbols_of_death, finality_eviscerate(6)
2:34.977 stealthed Z shadowstrike Fluffy_Pillow 79.2/100: 79% energy | 0.0/6: 0% combo_points temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6)
2:35.981 stealthed Z shadowstrike Fluffy_Pillow 81.6/100: 82% energy | 2.0/6: 33% combo_points temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6)
2:36.986 stealthed Z shadowstrike Fluffy_Pillow 58.9/100: 59% energy | 4.0/6: 67% combo_points temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6)
2:37.989 finish N eviscerate Fluffy_Pillow 36.2/100: 36% energy | 6.0/6: 100% combo_points temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6)
2:38.995 stealthed Z shadowstrike Fluffy_Pillow 52.6/100: 53% energy | 0.0/6: 0% combo_points temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death
2:40.000 build G backstab Fluffy_Pillow 54.9/100: 55% energy | 2.0/6: 33% combo_points temptation(3), master_of_subtlety, symbols_of_death
2:41.003 Waiting     1.800 sec 31.2/100: 31% energy | 4.0/6: 67% combo_points temptation(3), master_of_subtlety, symbols_of_death
2:42.803 build G backstab Fluffy_Pillow 51.6/100: 52% energy | 4.0/6: 67% combo_points master_of_subtlety, symbols_of_death
2:43.809 Waiting     0.700 sec 27.9/100: 28% energy | 6.0/6: 100% combo_points master_of_subtlety, symbols_of_death
2:44.509 finish N eviscerate Fluffy_Pillow 35.8/100: 36% energy | 6.0/6: 100% combo_points master_of_subtlety, symbols_of_death
2:45.515 stealth_cds W shadow_dance Fluffy_Pillow 52.2/100: 52% energy | 0.0/6: 0% combo_points symbols_of_death, finality_eviscerate(6)
2:45.515 stealthed Z shadowstrike Fluffy_Pillow 77.2/100: 77% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6)
2:46.520 stealthed Z shadowstrike Fluffy_Pillow 54.5/100: 55% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6)
2:47.524 stealthed Z shadowstrike Fluffy_Pillow 56.9/100: 57% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6)
2:48.529 Waiting     0.100 sec 34.2/100: 34% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6)
2:48.629 finish N eviscerate Fluffy_Pillow 35.3/100: 35% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6)
2:49.633 stealthed Z shadowstrike Fluffy_Pillow 51.7/100: 52% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
2:50.638 Waiting     2.000 sec 29.0/100: 29% energy | 2.0/6: 33% combo_points master_of_subtlety, symbols_of_death
2:52.638 build G backstab Fluffy_Pillow 51.6/100: 52% energy | 2.0/6: 33% combo_points master_of_subtlety, symbols_of_death
2:53.643 Waiting     2.100 sec 27.9/100: 28% energy | 4.0/6: 67% combo_points master_of_subtlety, symbols_of_death
2:55.743 build G backstab Fluffy_Pillow 51.6/100: 52% energy | 4.0/6: 67% combo_points symbols_of_death
2:56.746 finish M nightblade Fluffy_Pillow 28.0/100: 28% energy | 6.0/6: 100% combo_points symbols_of_death
2:57.751 cds L goremaws_bite Fluffy_Pillow 54.3/100: 54% energy | 0.0/6: 0% combo_points symbols_of_death, finality_nightblade(6)
2:58.755 build G backstab Fluffy_Pillow 70.6/100: 71% energy | 3.0/6: 50% combo_points symbols_of_death, goremaws_bite, finality_nightblade(6)
2:59.759 finish N eviscerate Fluffy_Pillow 52.0/100: 52% energy | 5.0/6: 83% combo_points symbols_of_death, goremaws_bite, finality_nightblade(6)
3:00.764 stealth_cds W shadow_dance Fluffy_Pillow 73.3/100: 73% energy | 0.0/6: 0% combo_points goremaws_bite, finality_eviscerate(5), finality_nightblade(6)
3:00.764 stealthed X symbols_of_death Fluffy_Pillow 98.3/100: 98% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, goremaws_bite, finality_eviscerate(5), finality_nightblade(6)
3:00.764 stealthed Z shadowstrike Fluffy_Pillow 63.3/100: 63% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, goremaws_bite, death, finality_eviscerate(5), finality_nightblade(6)
3:01.769 stealthed Z shadowstrike Fluffy_Pillow 70.7/100: 71% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, goremaws_bite, finality_eviscerate(5), finality_nightblade(6)
3:02.773 finish N eviscerate Fluffy_Pillow 53.0/100: 53% energy | 5.0/6: 83% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, goremaws_bite, finality_eviscerate(5), finality_nightblade(6)
3:03.778 stealthed Z shadowstrike Fluffy_Pillow 74.3/100: 74% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(6)
3:04.785 stealthed Z shadowstrike Fluffy_Pillow 51.7/100: 52% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(6)
3:05.791 Waiting     0.600 sec 29.1/100: 29% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death, finality_nightblade(6)
3:06.391 finish N eviscerate Fluffy_Pillow 35.8/100: 36% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death, finality_nightblade(6)
3:07.395 build G backstab Fluffy_Pillow 52.2/100: 52% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5), finality_nightblade(6)
3:08.398 Waiting     2.000 sec 28.5/100: 28% energy | 1.0/6: 17% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5), finality_nightblade(6)
3:10.398 build G backstab Fluffy_Pillow 51.1/100: 51% energy | 1.0/6: 17% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5), finality_nightblade(6)
3:11.401 Waiting     2.100 sec 27.4/100: 27% energy | 3.0/6: 50% combo_points symbols_of_death, finality_eviscerate(5), finality_nightblade(6)
3:13.501 build G backstab Fluffy_Pillow 51.1/100: 51% energy | 3.0/6: 50% combo_points symbols_of_death, finality_eviscerate(5), finality_nightblade(6)
3:14.505 Waiting     0.300 sec 27.4/100: 27% energy | 4.0/6: 67% combo_points symbols_of_death, finality_eviscerate(5), finality_nightblade(6)
3:14.805 cds K shadow_blades Fluffy_Pillow 30.8/100: 31% energy | 4.0/6: 67% combo_points symbols_of_death, finality_eviscerate(5), finality_nightblade(6)
3:15.000 Waiting     0.300 sec 33.0/100: 33% energy | 4.0/6: 67% combo_points symbols_of_death, shadow_blades, finality_eviscerate(5), finality_nightblade(6)
3:15.300 finish M nightblade Fluffy_Pillow 36.4/100: 36% energy | 5.0/6: 83% combo_points symbols_of_death, shadow_blades, finality_eviscerate(5), finality_nightblade(6)
3:16.305 stealth_cds W shadow_dance Fluffy_Pillow 62.7/100: 63% energy | 0.0/6: 0% combo_points symbols_of_death, shadow_blades, finality_eviscerate(5)
3:16.305 cds J use_item_draught_of_souls Fluffy_Pillow 87.7/100: 88% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(5)
3:19.305 stealthed X symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(5)
3:19.305 stealthed Z shadowstrike Fluffy_Pillow 65.0/100: 65% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, death, finality_eviscerate(5)
3:20.309 finish N eviscerate Fluffy_Pillow 42.3/100: 42% energy | 5.0/6: 83% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(5)
3:21.315 build G backstab Fluffy_Pillow 58.7/100: 59% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, shadow_blades
3:22.321 Waiting     1.500 sec 35.0/100: 35% energy | 2.0/6: 33% combo_points master_of_subtlety, symbols_of_death, shadow_blades
3:23.821 build G backstab Fluffy_Pillow 52.0/100: 52% energy | 4.0/6: 67% combo_points master_of_subtlety, symbols_of_death, shadow_blades
3:24.825 Waiting     0.600 sec 28.3/100: 28% energy | 6.0/6: 100% combo_points master_of_subtlety, symbols_of_death, shadow_blades
3:25.425 finish N eviscerate Fluffy_Pillow 35.1/100: 35% energy | 6.0/6: 100% combo_points master_of_subtlety, symbols_of_death, shadow_blades
3:26.431 build G backstab Fluffy_Pillow 51.4/100: 51% energy | 1.0/6: 17% combo_points symbols_of_death, shadow_blades, finality_eviscerate(6)
3:27.436 Waiting     2.100 sec 27.8/100: 28% energy | 3.0/6: 50% combo_points symbols_of_death, shadow_blades, finality_eviscerate(6)
3:29.536 build G backstab Fluffy_Pillow 51.5/100: 51% energy | 3.0/6: 50% combo_points symbols_of_death, shadow_blades, finality_eviscerate(6)
3:30.541 finish M nightblade Fluffy_Pillow 27.8/100: 28% energy | 6.0/6: 100% combo_points symbols_of_death, shadow_blades, finality_eviscerate(6)
3:31.546 stealth_cds W shadow_dance Fluffy_Pillow 54.2/100: 54% energy | 0.0/6: 0% combo_points symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6)
3:31.546 stealthed Z shadowstrike Fluffy_Pillow 79.2/100: 79% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6)
3:32.550 stealthed Z shadowstrike Fluffy_Pillow 56.5/100: 57% energy | 3.0/6: 50% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6)
3:33.553 Waiting     0.200 sec 33.8/100: 34% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6)
3:33.753 finish N eviscerate Fluffy_Pillow 36.1/100: 36% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6)
3:34.756 stealthed Z shadowstrike Fluffy_Pillow 52.4/100: 52% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6)
3:35.761 stealthed Z shadowstrike Fluffy_Pillow 54.8/100: 55% energy | 3.0/6: 50% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6)
3:36.765 Waiting     0.300 sec 32.1/100: 32% energy | 6.0/6: 100% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_nightblade(6)
3:37.065 finish N eviscerate Fluffy_Pillow 35.5/100: 35% energy | 6.0/6: 100% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_nightblade(6)
3:38.070 build G backstab Fluffy_Pillow 51.8/100: 52% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6)
3:39.076 Waiting     2.100 sec 28.2/100: 28% energy | 2.0/6: 33% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6)
3:41.176 build G backstab Fluffy_Pillow 51.9/100: 52% energy | 3.0/6: 50% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6)
3:42.181 Waiting     0.600 sec 28.2/100: 28% energy | 5.0/6: 83% combo_points symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6)
3:42.781 finish N eviscerate Fluffy_Pillow 35.0/100: 35% energy | 6.0/6: 100% combo_points symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6)
3:43.785 stealth_cds W shadow_dance Fluffy_Pillow 91.3/100: 91% energy | 0.0/6: 0% combo_points symbols_of_death, shadow_blades, finality_nightblade(6)
3:43.785 stealthed X symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6)
3:43.785 stealthed Z shadowstrike Fluffy_Pillow 65.0/100: 65% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, death, finality_nightblade(6)
3:44.790 stealthed Z shadowstrike Fluffy_Pillow 42.3/100: 42% energy | 3.0/6: 50% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6)
3:45.793 Waiting     0.572 sec 19.7/100: 20% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6)
3:46.365 finish M nightblade Fluffy_Pillow 26.1/100: 26% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6)
3:47.371 stealthed Z shadowstrike Fluffy_Pillow 52.5/100: 52% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades
3:48.377 Waiting     1.900 sec 29.8/100: 30% energy | 3.0/6: 50% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades
3:50.277 build G backstab Fluffy_Pillow 51.3/100: 51% energy | 4.0/6: 67% combo_points master_of_subtlety, symbols_of_death, shadow_blades
3:51.282 Waiting     0.700 sec 27.6/100: 28% energy | 6.0/6: 100% combo_points master_of_subtlety, symbols_of_death, shadow_blades
3:51.982 finish N eviscerate Fluffy_Pillow 35.5/100: 36% energy | 6.0/6: 100% combo_points master_of_subtlety, symbols_of_death, shadow_blades
3:52.987 stealth_cds W shadow_dance Fluffy_Pillow 51.9/100: 52% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6)
3:52.987 stealthed Z shadowstrike Fluffy_Pillow 76.9/100: 77% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6)
3:53.992 stealthed Z shadowstrike Fluffy_Pillow 54.2/100: 54% energy | 3.0/6: 50% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6)
3:54.996 finish N eviscerate Fluffy_Pillow 56.6/100: 57% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6)
3:56.000 stealthed Z shadowstrike Fluffy_Pillow 72.9/100: 73% energy | 1.0/6: 17% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades
3:57.007 stealthed Z shadowstrike Fluffy_Pillow 50.3/100: 50% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades
3:58.012 finish N eviscerate Fluffy_Pillow 52.6/100: 53% energy | 6.0/6: 100% combo_points master_of_subtlety, symbols_of_death
3:59.017 build G backstab Fluffy_Pillow 68.9/100: 69% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(6)
4:00.022 cds L goremaws_bite Fluffy_Pillow 45.3/100: 45% energy | 2.0/6: 33% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(6)
4:01.026 finish N eviscerate Fluffy_Pillow 61.6/100: 62% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death, goremaws_bite, finality_eviscerate(6)
4:02.031 stealth_cds W shadow_dance Fluffy_Pillow 83.0/100: 83% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, goremaws_bite
4:02.031 stealthed X symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, goremaws_bite
4:02.031 stealthed Z shadowstrike Fluffy_Pillow 65.0/100: 65% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, goremaws_bite, death
4:03.036 stealthed Z shadowstrike Fluffy_Pillow 72.3/100: 72% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, goremaws_bite
4:04.041 finish N eviscerate Fluffy_Pillow 54.7/100: 55% energy | 5.0/6: 83% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, goremaws_bite
4:05.045 stealthed Z shadowstrike Fluffy_Pillow 76.0/100: 76% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, goremaws_bite, finality_eviscerate(5)
4:06.049 stealthed Z shadowstrike Fluffy_Pillow 58.4/100: 58% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5)
4:07.055 Waiting     0.800 sec 35.7/100: 36% energy | 4.0/6: 67% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5)
4:07.855 finish M nightblade Fluffy_Pillow 44.7/100: 45% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5)
4:08.859 build G backstab Fluffy_Pillow 71.1/100: 71% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5), finality_nightblade(5)
4:09.864 Waiting     0.400 sec 47.4/100: 47% energy | 1.0/6: 17% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5), finality_nightblade(5)
4:10.264 build G backstab Fluffy_Pillow 51.9/100: 52% energy | 1.0/6: 17% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5), finality_nightblade(5)
4:11.270 Waiting     0.700 sec 28.3/100: 28% energy | 2.0/6: 33% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5), finality_nightblade(5)
4:11.970 stealth_cds T vanish Fluffy_Pillow 36.2/100: 36% energy | 2.0/6: 33% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5), finality_nightblade(5)
4:12.177 stealthed Z shadowstrike Fluffy_Pillow 63.5/100: 64% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, vanish, symbols_of_death, finality_eviscerate(5), finality_nightblade(5)
4:13.181 stealthed Z shadowstrike Fluffy_Pillow 65.9/100: 66% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, vanish, subterfuge, symbols_of_death, finality_eviscerate(5), finality_nightblade(5)
4:14.186 finish N eviscerate Fluffy_Pillow 43.2/100: 43% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, vanish, subterfuge, symbols_of_death, finality_eviscerate(5), finality_nightblade(5)
4:15.191 stealth_cds W shadow_dance Fluffy_Pillow 84.6/100: 85% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, finality_nightblade(5)
4:15.191 stealthed X symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(5)
4:15.191 stealthed Z shadowstrike Fluffy_Pillow 65.0/100: 65% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, death, finality_nightblade(5)
4:16.196 stealthed Z shadowstrike Fluffy_Pillow 42.3/100: 42% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(5)
4:17.198 Waiting     1.373 sec 19.7/100: 20% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(5)
4:18.571 finish N eviscerate Fluffy_Pillow 35.2/100: 35% energy | 5.0/6: 83% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(5)
4:19.575 stealthed Z shadowstrike Fluffy_Pillow 51.5/100: 51% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5), finality_nightblade(5)
4:20.579 build G backstab Fluffy_Pillow 53.8/100: 54% energy | 2.0/6: 33% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5), finality_nightblade(5)
4:21.583 stealth_cds U sprint Fluffy_Pillow 30.2/100: 30% energy | 3.0/6: 50% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5), finality_nightblade(5)
4:21.583 Waiting     1.900 sec 30.2/100: 30% energy | 3.0/6: 50% combo_points master_of_subtlety, sprint, symbols_of_death, finality_eviscerate(5), finality_nightblade(5), faster_than_light_trigger
4:23.483 build G backstab Fluffy_Pillow 51.6/100: 52% energy | 3.0/6: 50% combo_points master_of_subtlety, sprint, symbols_of_death, finality_eviscerate(5), finality_nightblade(5), faster_than_light_trigger
4:24.489 Waiting     0.100 sec 28.0/100: 28% energy | 4.0/6: 67% combo_points master_of_subtlety, sprint, symbols_of_death, finality_eviscerate(5), finality_nightblade(5), faster_than_light_trigger
4:24.589 finish M nightblade Fluffy_Pillow 54.1/100: 54% energy | 5.0/6: 83% combo_points master_of_subtlety_aura, vanish, subterfuge, sprint, symbols_of_death, finality_eviscerate(5), finality_nightblade(5)
4:25.594 stealthed Z shadowstrike Fluffy_Pillow 80.4/100: 80% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, vanish, subterfuge, sprint, symbols_of_death, finality_eviscerate(5)
4:26.598 stealthed Z shadowstrike Fluffy_Pillow 57.8/100: 58% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, vanish, subterfuge, sprint, symbols_of_death, finality_eviscerate(5)
4:27.603 build G backstab Fluffy_Pillow 60.1/100: 60% energy | 4.0/6: 67% combo_points master_of_subtlety, sprint, symbols_of_death, finality_eviscerate(5)
4:28.607 finish N eviscerate Fluffy_Pillow 36.4/100: 36% energy | 5.0/6: 83% combo_points master_of_subtlety, sprint, symbols_of_death, finality_eviscerate(5)
4:29.609 stealth_cds W shadow_dance Fluffy_Pillow 52.8/100: 53% energy | 1.0/6: 17% combo_points master_of_subtlety, symbols_of_death
4:29.609 stealthed Z shadowstrike Fluffy_Pillow 77.8/100: 78% energy | 1.0/6: 17% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
4:30.614 stealthed Z shadowstrike Fluffy_Pillow 55.1/100: 55% energy | 3.0/6: 50% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
4:31.618 Waiting     0.300 sec 32.4/100: 32% energy | 5.0/6: 83% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
4:31.918 finish N eviscerate Fluffy_Pillow 35.8/100: 36% energy | 5.0/6: 83% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
4:32.924 stealthed Z shadowstrike Fluffy_Pillow 52.2/100: 52% energy | 1.0/6: 17% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5)
4:33.930 stealthed Z shadowstrike Fluffy_Pillow 54.5/100: 55% energy | 3.0/6: 50% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5)
4:34.935 Waiting     0.300 sec 31.9/100: 32% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5)
4:35.235 finish N eviscerate Fluffy_Pillow 35.3/100: 35% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5)
4:36.240 cds J use_item_draught_of_souls Fluffy_Pillow 51.6/100: 52% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death
4:39.305 build G backstab Fluffy_Pillow 86.2/100: 86% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death
4:40.310 build G backstab Fluffy_Pillow 62.5/100: 63% energy | 1.0/6: 17% combo_points symbols_of_death
4:41.314 Waiting     1.100 sec 38.9/100: 39% energy | 3.0/6: 50% combo_points symbols_of_death
4:42.414 build G backstab Fluffy_Pillow 51.3/100: 51% energy | 3.0/6: 50% combo_points symbols_of_death
4:43.418 Waiting     1.900 sec 27.6/100: 28% energy | 4.0/6: 67% combo_points symbols_of_death
4:45.318 finish N eviscerate Fluffy_Pillow 49.1/100: 49% energy | 5.0/6: 83% combo_points symbols_of_death
4:46.323 stealth_cds W shadow_dance Fluffy_Pillow 65.4/100: 65% energy | 0.0/6: 0% combo_points symbols_of_death, finality_eviscerate(5)
4:46.323 stealthed Z shadowstrike Fluffy_Pillow 90.4/100: 90% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5)
4:47.328 stealthed Z shadowstrike Fluffy_Pillow 92.8/100: 93% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5)
4:48.332 stealthed Z shadowstrike Fluffy_Pillow 70.1/100: 70% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5)
4:49.338 finish N eviscerate Fluffy_Pillow 47.5/100: 47% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5)
4:50.343 stealthed Z shadowstrike Fluffy_Pillow 63.8/100: 64% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
4:51.350 Waiting     0.900 sec 41.2/100: 41% energy | 2.0/6: 33% combo_points master_of_subtlety, symbols_of_death
4:52.250 build G backstab Fluffy_Pillow 51.3/100: 51% energy | 3.0/6: 50% combo_points master_of_subtlety, symbols_of_death
4:53.255 Waiting     0.300 sec 27.7/100: 28% energy | 4.0/6: 67% combo_points master_of_subtlety, symbols_of_death

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 8806 8481 0
Agility 30616 28910 18504 (13012)
Stamina 48391 48391 28183
Intellect 5325 5000 0
Spirit 0 0 0
Health 2903460 2903460 0
Energy 100 100 0
Combo Points 6 6 0
Crit 23.64% 23.64% 5456
Haste 12.88% 12.88% 4831
Damage / Heal Versatility 9.03% 8.23% 3909
Attack Power 30616 28910 0
Mastery 80.81% 80.81% 8510
Armor 2297 2297 2297
Run Speed 8 0 0

Gear

Source Slot Average Item Level: 891.00
Local Head Cowl of Fright
ilevel: 885, stats: { 300 Armor, +2829 Sta, +1886 AgiInt, +1015 Mastery, +547 Crit, +1076 unknown }
Local Neck Sea Fan Pendant
ilevel: 880, stats: { +1519 Sta, +1633 Vers, +965 Mastery }, enchant: mark_of_the_hidden_satyr
Local Shoulders Steelgazer Hide Mantle
ilevel: 880, stats: { 273 Armor, +1351 AgiInt, +2027 Sta, +673 Haste, +476 Vers, +771 unknown }
Local Shirt Common Gray Shirt
ilevel: 1
Local Chest Biornskin Vest
ilevel: 890, stats: { 376 Armor, +1977 AgiInt, +2965 Sta, +1034 Crit, +557 Mastery }
Local Waist Strand of Whelk Shells
ilevel: 880, stats: { 205 Armor, +2026 Sta, +1351 AgiInt, +673 Haste, +476 Mastery }, gems: { +150 Mastery }
Local Legs Legwraps of Unworthy Souls
ilevel: 880, stats: { 318 Armor, +2701 Sta, +1801 AgiInt, +964 Mastery, +570 Haste }
Local Feet Shadow Satyr's Walk
ilevel: 910, stats: { 276 Armor, +2680 Sta, +1786 Agi, +827 Haste, +459 Mastery }
Local Wrists Denial of the Half-Giants
ilevel: 910, stats: { 176 Armor, +2010 Sta, +1340 Agi, +276 Crit, +689 Mastery }
Local Hands Cruel Vice Grips
ilevel: 885, stats: { 231 Armor, +2122 Sta, +1415 AgiInt, +686 Crit, +485 Mastery }
Local Finger1 Grubby Silver Ring
ilevel: 880, stats: { +1519 Sta, +1484 Crit, +1114 Vers }, gems: { +150 Vers }, enchant: { +200 Mastery }
Local Finger2 Ring of Collapsing Futures
ilevel: 870, stats: { +1385 Sta, +1677 Mastery, +768 Haste, +419 Avoidance }, enchant: { +200 Vers }
Local Trinket1 Convergence of Fates
ilevel: 910, stats: { +2264 StrAgi }
Local Trinket2 Draught of Souls
ilevel: 910, stats: { +1225 Haste }
Local Back Drape of the Mana-Starved
ilevel: 875, stats: { 142 Armor, +1450 Sta, +967 StrAgiInt, +586 Crit, +259 Vers }, gems: { +200 Agi }, enchant: { +200 Agi }
Local Main Hand Fangs of the Devourer
ilevel: 906, weapon: { 3844 - 7140, 1.8 }, stats: { +983 Agi, +1475 Sta, +368 Crit, +353 Mastery }, relics: { +53 ilevels, +51 ilevels, +52 ilevels }
Local Off Hand Fangs of the Devourer
ilevel: 906, weapon: { 3844 - 7140, 1.8 }, stats: { +983 Agi, +1475 Sta, +368 Crit, +353 Mastery }

Talents

Level
15 Master of Subtlety (Subtlety Rogue) Weaponmaster (Subtlety Rogue) Gloomblade (Subtlety Rogue)
30 Nightstalker Subterfuge Shadow Focus
45 Deeper Stratagem Anticipation Vigor
60 Soothing Darkness (Subtlety Rogue) Elusiveness Cheat Death
75 Strike from the Shadows (Subtlety Rogue) Prey on the Weak Tangled Shadow (Subtlety Rogue)
90 Premeditation (Subtlety Rogue) Alacrity Enveloping Shadows (Subtlety Rogue)
100 Master of Shadows (Subtlety Rogue) Marked for Death Death from Above

Profile

rogue="CoF+DoS"
origin="https://eu.api.battle.net/wow/character/dalaran/Esdeåth/advanced"
level=110
race=human
role=attack
position=back
professions=alchemy=800/enchanting=133
talents=1210011
artifact=17:0:0:0:0:851:1:852:3:853:3:854:3:855:3:856:3:857:3:858:3:859:3:860:3:861:1:862:1:863:1:864:1:865:1:866:1:1349:1:1386:14
spec=subtlety

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,name=flask_of_the_seventh_demon
actions.precombat+=/augmentation,name=defiled
actions.precombat+=/food,name=seedbattered_fish_plate
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/stealth
actions.precombat+=/potion,name=old_war
actions.precombat+=/marked_for_death,if=raid_event.adds.in>40
# Defined variables that doesn't change during the fight
actions.precombat+=/variable,name=ssw_refund,value=equipped.shadow_satyrs_walk*(4+ssw_refund_offset)
actions.precombat+=/variable,name=stealth_threshold,value=(15+talent.vigor.enabled*35+talent.master_of_shadows.enabled*30+variable.ssw_refund)
actions.precombat+=/enveloping_shadows,if=combo_points>=5
actions.precombat+=/symbols_of_death

# Executed every time the actor is available.
actions=call_action_list,name=cds
# Fully switch to the Stealthed Rotation (by doing so, it forces pooling if nothing is available)
actions+=/run_action_list,name=stealthed,if=stealthed.all
actions+=/call_action_list,name=finish,if=combo_points>=5|(combo_points>=4&spell_targets.shuriken_storm>=3&spell_targets.shuriken_storm<=4)
actions+=/call_action_list,name=stealth_als,if=combo_points.deficit>=2+talent.premeditation.enabled
actions+=/call_action_list,name=build,if=energy.deficit<=variable.stealth_threshold

# Builders
actions.build=shuriken_storm,if=spell_targets.shuriken_storm>=2
actions.build+=/gloomblade
actions.build+=/backstab

# Cooldowns
actions.cds=potion,name=old_war,if=buff.bloodlust.react|target.time_to_die<=25|buff.shadow_blades.up
actions.cds+=/use_item,slot=finger2,if=(buff.shadow_blades.up&stealthed.rogue)|target.time_to_die<20
actions.cds+=/use_item,slot=trinket2,if=(buff.shadow_blades.up&stealthed.rogue)|target.time_to_die<20
actions.cds+=/blood_fury,if=stealthed.rogue
actions.cds+=/berserking,if=stealthed.rogue
actions.cds+=/arcane_torrent,if=stealthed.rogue&energy.deficit>70
actions.cds+=/shadow_blades,if=combo_points<=2|(equipped.denial_of_the_halfgiants&combo_points>=1)
actions.cds+=/goremaws_bite,if=!stealthed.all&cooldown.shadow_dance.charges_fractional<=2.45&((combo_points.deficit>=4-(time<10)*2&energy.deficit>50+talent.vigor.enabled*25-(time>=10)*15)|target.time_to_die<8)
actions.cds+=/marked_for_death,target_if=min:target.time_to_die,if=target.time_to_die<combo_points.deficit|(raid_event.adds.in>40&combo_points.deficit>=4+talent.deeper_strategem.enabled+talent.anticipation.enabled)

# Finishers
actions.finish=enveloping_shadows,if=buff.enveloping_shadows.remains<target.time_to_die&buff.enveloping_shadows.remains<=combo_points*1.8
actions.finish+=/death_from_above,if=spell_targets.death_from_above>=6
actions.finish+=/nightblade,cycle_targets=1,if=target.time_to_die>8&((refreshable&(!finality|buff.finality_nightblade.up))|remains<tick_time)
actions.finish+=/death_from_above
actions.finish+=/eviscerate

# Stealth Action List Starter
actions.stealth_als=call_action_list,name=stealth_cds,if=energy.deficit<=variable.stealth_threshold&(!equipped.shadow_satyrs_walk|cooldown.shadow_dance.charges_fractional>=2.45|energy.deficit>=10)
actions.stealth_als+=/call_action_list,name=stealth_cds,if=spell_targets.shuriken_storm>=5
actions.stealth_als+=/call_action_list,name=stealth_cds,if=(cooldown.shadowmeld.up&!cooldown.vanish.up&cooldown.shadow_dance.charges<=1)
actions.stealth_als+=/call_action_list,name=stealth_cds,if=target.time_to_die<12*cooldown.shadow_dance.charges_fractional*(1+equipped.shadow_satyrs_walk*0.5)

# Stealth Cooldowns
actions.stealth_cds=shadow_dance,if=charges_fractional>=2.45
actions.stealth_cds+=/vanish
actions.stealth_cds+=/sprint_offensive
actions.stealth_cds+=/shadow_dance,if=charges>=2&combo_points<=1
actions.stealth_cds+=/pool_resource,for_next=1,extra_amount=40
actions.stealth_cds+=/shadowmeld,if=energy>=40&energy.deficit>=10+variable.ssw_refund
actions.stealth_cds+=/shadow_dance,if=combo_points<=1

# Stealthed Rotation
actions.stealthed=symbols_of_death,if=(buff.symbols_of_death.remains<target.time_to_die-4&buff.symbols_of_death.remains<=buff.symbols_of_death.duration*0.3)|equipped.shadow_satyrs_walk&energy.time_to_max<0.25
actions.stealthed+=/call_action_list,name=finish,if=combo_points>=5
actions.stealthed+=/shuriken_storm,if=buff.shadowmeld.down&((combo_points.deficit>=3&spell_targets.shuriken_storm>=2+talent.premeditation.enabled+equipped.shadow_satyrs_walk)|buff.the_dreadlords_deceit.stack>=29)
actions.stealthed+=/shadowstrike

head=cowl_of_fright,id=139205,bonus_id=1805/43/1507/3337
neck=sea_fan_pendant,id=142428,bonus_id=3507/1497,enchant=mark_of_the_hidden_satyr
shoulders=steelgazer_hide_mantle,id=134154,bonus_id=3417/43/1542/3337
back=drape_of_the_manastarved,id=141543,bonus_id=1808/1487/3337,gems=200agi,enchant=200agi
chest=biornskin_vest,id=134197,bonus_id=3417/1552/3337
shirt=common_gray_shirt,id=3428
wrists=denial_of_the_halfgiants,id=137100,bonus_id=3459/3458
hands=cruel_vice_grips,id=133617,bonus_id=3510/1537/3337
waist=strand_of_whelk_shells,id=142416,bonus_id=3507/1808/1497,gems=150mastery
legs=legwraps_of_unworthy_souls,id=133616,bonus_id=3418/1532/3337
feet=shadow_satyrs_walk,id=137032,bonus_id=3459/3458
finger1=grubby_silver_ring,id=139236,bonus_id=1806/1808/1502,gems=150vers,enchant=200mastery
finger2=ring_of_collapsing_futures,id=142173,bonus_id=40/3453/1482/3336,enchant=200vers
trinket1=convergence_of_fates,id=140806,bonus_id=3519
trinket2=draught_of_souls,id=140808,bonus_id=3519
main_hand=fangs_of_the_devourer,id=128476,bonus_id=743,gem_id=139267/142512/139253/0,relic_id=1806:1507:3336/3468:1492/1806:1502/0
off_hand=fangs_of_the_devourer,id=128479

# Gear Summary
# gear_ilvl=891.06
# gear_agility=18504
# gear_stamina=28183
# gear_crit_rating=5349
# gear_haste_rating=4736
# gear_mastery_rating=8343
# gear_versatility_rating=3832
# gear_avoidance_rating=419
# gear_armor=2297

CoF+EEF : 596429 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
596428.8 596428.8 628.6 / 0.105% 87860.4 / 14.7% 19654.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
30.3 30.3 Energy 19.68% 59.6 100.0% 100%
Origin https://eu.api.battle.net/wow/character/dalaran/Esdeåth/advanced
Talents
  • 15: Master of Subtlety (Subtlety Rogue)
  • 30: Subterfuge
  • 45: Deeper Stratagem
  • 90: Premeditation (Subtlety Rogue)
  • 100: Master of Shadows (Subtlety Rogue)
  • Talent Calculator
Artifact
Professions
  • alchemy: 800
  • enchanting: 133

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
CoF+EEF 596429
auto_attack_mh 7040 1.2% 80.6 2.92sec 26428 17084 Direct 80.6 25050 50100 26428 24.5% 19.0%  

Stats details: auto_attack_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 80.63 80.63 0.00 0.00 1.5470 0.0000 2130848.98 3132549.83 31.98 17083.56 17083.56
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 45.54 56.49% 25050.10 19317 25498 25052.74 23985 25498 1140878 1677198 31.98
crit 19.76 24.51% 50100.14 38633 50996 50099.96 47022 50996 989971 1455352 31.98
miss 15.33 19.01% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_mh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
auto_attack_oh 3506 0.6% 80.2 2.93sec 13229 8508 Direct 80.2 12526 25047 13229 24.7% 19.1%  

Stats details: auto_attack_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 80.21 80.21 0.00 0.00 1.5549 0.0000 1061171.94 1560023.27 31.98 8508.03 8508.03
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 45.08 56.20% 12526.01 9658 12749 12526.99 12050 12749 564660 830103 31.98
crit 19.82 24.71% 25047.16 19317 25498 25050.01 23790 25498 496512 729920 31.98
miss 15.31 19.09% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_oh

Static Values
  • id:1
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Backstab 27116 4.6% 47.7 6.04sec 171873 171103 Direct 47.7 137968 275895 171867 24.6% 0.0%  

Stats details: backstab

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.65 47.65 0.00 0.00 1.0045 0.0000 8190545.77 12040878.11 31.98 171103.34 171103.34
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 35.94 75.42% 137967.53 106732 140886 137978.39 134105 140886 4958622 7289644 31.98
crit 11.71 24.58% 275895.49 213463 281772 275899.44 256156 281772 3231924 4751234 31.98
 
 

Action details: backstab

Static Values
  • id:53
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:53
  • name:Backstab
  • school:physical
  • tooltip:
  • description:Stab the target, causing ${$sw2*$<mult>} Physical damage. Damage increased by {$s4=30}% when you are behind your target. |cFFFFFFFFAwards {$s3=1} combo $lpoint:points;.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.70
 
Collapse 1847 0.3% 6.6 29.75sec 83055 0 Direct 6.6 66621 133230 83051 24.7% 0.0%  

Stats details: collapse

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.64 6.64 0.00 0.00 0.0000 0.0000 551578.30 551578.30 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.00 75.33% 66620.73 50574 66758 66192.70 0 66758 333277 333277 0.00
crit 1.64 24.67% 133230.02 101148 133516 103016.34 0 133516 218301 218301 0.00
 
 

Action details: collapse

Static Values
  • id:234142
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:15.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:234142
  • name:Collapse
  • school:shadow
  • tooltip:
  • description:Deal {$s1=40000} Shadow damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:40000.00
  • base_dd_max:40000.00
 
Eviscerate 199015 33.4% 59.5 5.02sec 1004663 1000169 Direct 59.5 720174 1439334 1004691 39.6% 0.0%  

Stats details: eviscerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 59.54 59.54 0.00 0.00 1.0045 0.0000 59813120.05 87930952.13 31.98 1000169.22 1000169.22
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 35.98 60.44% 720173.56 432169 1008351 720391.69 654273 784717 25914365 38096572 31.98
crit 23.55 39.56% 1439333.66 864338 2016703 1439624.37 1255816 1662623 33898755 49834381 31.98
 
 

Action details: eviscerate

Static Values
  • id:196819
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.15
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:196819
  • name:Eviscerate
  • school:physical
  • tooltip:
  • description:Finishing move that disembowels the target, causing damage per combo point. 1 point : ${$m1*1} damage 2 points: ${$m1*2} damage 3 points: ${$m1*3} damage 4 points: ${$m1*4} damage 5 points: ${$m1*5} damage{$?s193531=false}[ 6 points: ${$m1*6} damage][]
Weapon
  • normalized:false
  • weapon_power_mod:0.000000
  • weapon_multiplier:0.00
 
Goremaw's Bite 0 (10050) 0.0% (1.7%) 4.6 64.18sec 654518 651634

Stats details: goremaws_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.63 0.00 0.00 0.00 1.0045 0.0000 0.00 0.00 0.00 651633.55 651633.55
 
 

Action details: goremaws_bite

Static Values
  • id:209782
  • school:shadow
  • resource:none
  • range:8.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!stealthed.all&cooldown.shadow_dance.charges_fractional<=2.45&((combo_points.deficit>=4-(time<10)*2&energy.deficit>50+talent.vigor.enabled*25-(time>=10)*15)|target.time_to_die<8)
Spelldata
  • id:209782
  • name:Goremaw's Bite
  • school:physical
  • tooltip:
  • description:Lashes out at the target, inflicting ${$209783sw2+$209784sw2} Shadow damage and reducing movement speed by {$209786s1=60}% for {$209786d=8 seconds}. Grants $220901o2 Energy over {$220901d=6 seconds}. |cFFFFFFFFAwards {$220901s1=3} combo $lpoint:points;.|r
 
    Goremaw's Bite (_mh) 6692 1.1% 4.6 64.18sec 435811 0 Direct 4.6 349680 699275 435814 24.6% 0.0%  

Stats details: goremaws_bite_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.63 4.63 0.00 0.00 0.0000 0.0000 2015854.97 2015854.97 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 3.49 75.36% 349680.22 272066 359127 348560.84 0 359127 1218947 1218947 0.00
crit 1.14 24.64% 699275.44 544132 718254 506948.07 0 718254 796908 796908 0.00
 
 

Action details: goremaws_bite_mh

Static Values
  • id:209783
  • school:shadow
  • resource:none
  • range:8.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:209783
  • name:Goremaw's Bite
  • school:shadow
  • tooltip:
  • description:{$@spelldesc209782=Lashes out at the target, inflicting ${$209783sw2+$209784sw2} Shadow damage and reducing movement speed by {$209786s1=60}% for {$209786d=8 seconds}. Grants $220901o2 Energy over {$220901d=6 seconds}. |cFFFFFFFFAwards {$220901s1=3} combo $lpoint:points;.|r}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:10.00
 
    Goremaw's Bite (_oh) 3358 0.6% 4.6 64.18sec 218707 0 Direct 4.6 174862 349572 218700 25.1% 0.0%  

Stats details: goremaws_bite_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.63 4.63 0.00 0.00 0.0000 0.0000 1011634.52 1011634.52 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 3.46 74.90% 174862.16 136039 179572 174135.24 0 179572 605842 605842 0.00
crit 1.16 25.10% 349571.61 272079 359144 253009.15 0 359144 405793 405793 0.00
 
 

Action details: goremaws_bite_oh

Static Values
  • id:209784
  • school:shadow
  • resource:none
  • range:8.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:209784
  • name:Goremaw's Bite
  • school:shadow
  • tooltip:
  • description:{$@spelldesc209782=Lashes out at the target, inflicting ${$209783sw2+$209784sw2} Shadow damage and reducing movement speed by {$209786s1=60}% for {$209786d=8 seconds}. Grants $220901o2 Energy over {$220901d=6 seconds}. |cFFFFFFFFAwards {$220901s1=3} combo $lpoint:points;.|r}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:10.00
 
Mark of the Hidden Satyr 8918 1.5% 16.5 17.93sec 162954 0 Direct 16.5 130837 261658 162956 24.6% 0.0%  

Stats details: mark_of_the_hidden_satyr

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.48 16.48 0.00 0.00 0.0000 0.0000 2685264.78 2685264.78 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 12.43 75.45% 130836.72 100276 132364 130845.03 123808 132364 1626706 1626706 0.00
crit 4.05 24.55% 261657.87 200552 264729 257316.15 0 264729 1058559 1058559 0.00
 
 

Action details: mark_of_the_hidden_satyr

Static Values
  • id:191259
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191259
  • name:Mark of the Hidden Satyr
  • school:fire
  • tooltip:
  • description:Deals fire damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:2.500000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Nightblade 123611 20.8% 17.0 17.54sec 2184403 2174633 Periodic 145.7 205052 409994 255524 24.6% 0.0% 96.7%

Stats details: nightblade

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.05 0.00 145.73 145.73 1.0045 2.0000 37238408.48 37238408.48 0.00 120673.55 2174632.59
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 109.8 75.37% 205052.08 137013 266408 205063.86 196668 219011 22523061 22523061 0.00
crit 35.9 24.63% 409993.90 274025 532816 410062.14 382569 447836 14715348 14715348 0.00
 
 

Action details: nightblade

Static Values
  • id:195452
  • school:shadow
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:25.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:target.time_to_die>8&((refreshable&(!finality|buff.finality_nightblade.up))|remains<tick_time)
Spelldata
  • id:195452
  • name:Nightblade
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec and snared by attacks.
  • description:Finishing move that infects the target with shadowy energy, dealing Shadow damage over time and causing attacks against the target to reduce movement speed by {$206760s1=30}% for {$206760d=8 seconds}. Lasts longer per combo point. 1 point : ${$m1*8/2} over 8 sec 2 points: ${$m1*10/2} over 10 sec 3 points: ${$m1*12/2} over 12 sec 4 points: ${$m1*14/2} over 14 sec 5 points: ${$m1*16/2} over 16 sec{$?s193531=false}[ 6 points: ${$m1*18/2} over 18 sec][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:1.380000
  • spell_power_mod.tick:0.000000
  • base_td:1.00
  • dot_duration:6.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Potion of the Old War 18858 3.1% 23.3 5.03sec 238790 0 Direct 23.3 191883 383785 238796 24.4% 0.0%  

Stats details: potion_of_the_old_war

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.33 23.33 0.00 0.00 0.0000 0.0000 5571310.35 8190353.94 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.63 75.56% 191883.05 146122 192882 191882.54 183987 192882 3382660 4972830 31.98
crit 5.70 24.44% 383784.86 292245 385763 382623.46 0 385763 2188651 3217524 31.88
 
 

Action details: potion_of_the_old_war

Static Values
  • id:188028
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188028
  • name:Potion of the Old War
  • school:physical
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:135920.00
  • base_dd_max:203880.00
 
Shadow Blades 0 (24585) 0.0% (4.1%) 3.5 98.49sec 2077922 0

Stats details: shadow_blades

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.55 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: shadow_blades

Static Values
  • id:121471
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:combo_points<=2|(equipped.denial_of_the_halfgiants&combo_points>=1)
Spelldata
  • id:121471
  • name:Shadow Blades
  • school:physical
  • tooltip:Autoattacks deal pure Shadow damage. Combo-point-generating attacks generate {$s2=1} additional combo point.
  • description:Draws upon surrounding shadows to empower your weapons, causing auto attacks to deal Shadow damage and abilities that generate combo points to generate 1 additional combo point. Lasts {$d=15 seconds}.
 
    Shadow Blade (_mh) 16389 2.7% 106.2 2.69sec 46295 31189 Direct 106.2 37156 74314 46295 24.6% 0.0%  

Stats details: shadow_blade_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 106.19 106.19 0.00 0.00 1.4843 0.0000 4915988.54 4915988.54 0.00 31189.46 31189.46
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 80.07 75.41% 37155.95 28397 37484 37156.74 36519 37484 2975142 2975142 0.00
crit 26.12 24.59% 74313.76 56794 74969 74315.36 72034 74969 1940847 1940847 0.00
 
 

Action details: shadow_blade_mh

Static Values
  • id:121473
  • school:shadow
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:121473
  • name:Shadow Blade
  • school:shadow
  • tooltip:
  • description:Strike with dark energy, dealing Shadow damage equal to {$s1=1}% weapon damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
    Shadow Blade Off-hand 8196 1.4% 106.2 2.69sec 23151 15597 Direct 106.2 18578 37154 23151 24.6% 0.0%  

Stats details: shadow_blade_offhand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 106.19 106.19 0.00 0.00 1.4843 0.0000 2458368.56 2458368.56 0.00 15596.81 15596.81
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 80.05 75.39% 18578.38 14199 18742 18578.71 18269 18742 1487264 1487264 0.00
crit 26.14 24.61% 37154.39 28397 37484 37154.80 35999 37484 971105 971105 0.00
 
 

Action details: shadow_blade_offhand

Static Values
  • id:121474
  • school:shadow
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:121474
  • name:Shadow Blade Off-hand
  • school:shadow
  • tooltip:
  • description:Strike with dark energy, dealing Shadow damage equal to {$s1=1}% weapon damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Shadow Nova 11575 1.9% 33.8 9.10sec 102955 0 Direct 33.8 82592 165182 102955 24.7% 0.0%  

Stats details: shadow_nova

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 33.80 33.80 0.00 0.00 0.0000 0.0000 3479942.11 3479942.11 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 25.47 75.34% 82591.84 68830 82595 82591.87 81786 82595 2103341 2103341 0.00
crit 8.33 24.66% 165181.57 137659 165191 165149.82 0 165191 1376601 1376601 0.00
 
 

Action details: shadow_nova

Static Values
  • id:197800
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:5.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:197800
  • name:Shadow Nova
  • school:shadow
  • tooltip:
  • description:Deals {$s1=0} Shadow damage to enemies with $A1 yards.
 
Shadowstrike 130042 (160308) 21.8% (26.9%) 112.0 2.70sec 429987 428062 Direct 112.0 260259 520529 348781 34.0% 0.0%  

Stats details: shadowstrike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 112.00 112.00 0.00 0.00 1.0045 0.0000 39062532.39 57425622.72 31.98 428062.11 428062.11
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.91 65.99% 260259.14 216893 260271 260259.52 258172 260271 19235070 28277376 31.98
crit 38.09 34.01% 520528.55 433785 520542 520528.80 513602 520542 19827462 29148247 31.98
 
 

Action details: shadowstrike

Static Values
  • id:185438
  • school:physical
  • resource:energy
  • range:15.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:185438
  • name:Shadowstrike
  • school:physical
  • tooltip:
  • description:Strike through the shadows, $?a231718[appearing behind your target and ][]dealing $sw2 Physical damage. |cFFFFFFFFAwards {$s3=1} combo $lpoint:points;.|r
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:8.50
 
    Soul Rip 30266 5.1% 111.3 2.68sec 81696 0 Direct 111.3 65553 131106 81697 24.6% 0.0%  

Stats details: soul_rip

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 111.33 111.33 0.00 0.00 0.0000 0.0000 9095311.22 9095311.22 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 83.91 75.37% 65553.23 65553 65553 65553.23 65553 65553 5500859 5500859 0.00
crit 27.42 24.63% 131106.47 131106 131106 131106.47 131106 131106 3594452 3594452 0.00
 
 

Action details: soul_rip

Static Values
  • id:220893
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:220893
  • name:Soul Rip
  • school:shadow
  • tooltip:
  • description:{$@spelldesc209835=After using Shadowstrike or Cheap Shot, Akaari's Soul appears $m1 sec later and Soul Rips your target, dealing {$220893s1=1} Shadow damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:1.500000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Simple Action Stats Execute Interval
CoF+EEF
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:CoF+EEF
  • harmful:false
  • if_expr:
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:CoF+EEF
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:CoF+EEF
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Shadow Dance 28.3 10.67sec

Stats details: shadow_dance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 28.31 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: shadow_dance

Static Values
  • id:185313
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:charges_fractional>=2.45
Spelldata
  • id:185313
  • name:Shadow Dance
  • school:physical
  • tooltip:
  • description:Allows use of all Stealth abilities and grants all the combat benefits of Stealth for {$d=3 seconds}. Effect not broken from taking damage or attacking. {$?s14062=false}[Movement speed while active is increased by {$1784s3=0}% and damage dealt is increased by {$1784s4=0}%. ]?s108209[Abilities cost {$112942s1=75}% less while active. ][]{$?s31223=false}[Attacks from Shadow Dance and for {$31223s1=5} sec after deal {$31665s1=10}% more damage. ][]
 
Sprint 2.7 122.54sec

Stats details: sprint

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.74 0.00 86.74 0.00 0.0000 0.2500 0.00 0.00 0.00 0.00 0.00
 
 

Action details: sprint

Static Values
  • id:2983
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:2983
  • name:Sprint
  • school:physical
  • tooltip:Movement speed increased by $w1%.
  • description:Increases your movement speed by {$s1=70}% for {$d=8 seconds}. Usable while stealthed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:0.25
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Symbols of Death 14.3 22.12sec

Stats details: symbols_of_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.26 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: symbols_of_death

Static Values
  • id:212283
  • school:physical
  • resource:energy
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:10.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:212283
  • name:Symbols of Death
  • school:physical
  • tooltip:All damage done increased by {$s1=20}%.
  • description:Invoke ancient symbols of power, increasing all damage you deal by {$s1=20}% for {$d=35 seconds}, and causing your next Shadowstrike to critically strike. Unaffected by the global cooldown.
 
Vanish 2.8 122.57sec

Stats details: vanish

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.84 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: vanish

Static Values
  • id:1856
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:1856
  • name:Vanish
  • school:physical
  • tooltip:Improved stealth.
  • description:Allows you to vanish from sight, entering stealth while in combat. For the first {$11327d=3 seconds} after vanishing, damage and harmful effects received will not break stealth. Also breaks movement impairing effects.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Arcane Enchant 1.2 0.1 105.5sec 85.8sec 8.08% 8.08% 0.1(0.1) 1.1

Buff details

  • buff initial source:CoF+EEF
  • cooldown name:buff_arcane_enchant
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:4828.95

Stack Uptimes

  • arcane_enchant_1:8.08%

Trigger Attempt Success

  • trigger_pct:74.51%

Spelldata details

  • id:225730
  • name:Arcane Enchant
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc225129=Your melee and ranged attacks have a chance to grant you a Fiery, Frost, or Arcane enchant for {$225726d=20 seconds}. }
  • max_stacks:0
  • duration:20.00
  • cooldown:1.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 26.25% 0.0(0.0) 1.0

Buff details

  • buff initial source:CoF+EEF
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Death 14.3 0.0 21.3sec 22.1sec 1.34% 12.60% 0.0(0.0) 0.2

Buff details

  • buff initial source:CoF+EEF
  • cooldown name:buff_death
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • death_1:1.34%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:227151
  • name:Death
  • tooltip:Your next Shadowstrike will critically strike.
  • description:{$@spelldesc212283=Invoke ancient symbols of power, increasing all damage you deal by {$s1=20}% for {$d=35 seconds}, and causing your next Shadowstrike to critically strike. Unaffected by the global cooldown.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Faster Than Light Trigger 2.7 0.0 122.5sec 122.5sec 2.72% 2.72% 0.0(0.0) 2.7

Buff details

  • buff initial source:CoF+EEF
  • cooldown name:buff_faster_than_light_trigger
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • faster_than_light_trigger_1:2.72%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:197270
  • name:Faster Than Light Trigger
  • tooltip:
  • description:
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
Fiery Enchant 1.2 0.1 103.9sec 86.4sec 7.87% 7.87% 0.1(0.1) 1.1

Buff details

  • buff initial source:CoF+EEF
  • cooldown name:buff_fiery_enchant
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:4828.95

Stack Uptimes

  • fiery_enchant_1:7.87%

Trigger Attempt Success

  • trigger_pct:73.51%

Spelldata details

  • id:225726
  • name:Fiery Enchant
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc225129=Your melee and ranged attacks have a chance to grant you a Fiery, Frost, or Arcane enchant for {$225726d=20 seconds}. }
  • max_stacks:0
  • duration:20.00
  • cooldown:1.00
  • default_chance:0.00%
Finality: Eviscerate 30.0 0.0 10.1sec 10.1sec 48.85% 49.58% 0.0(0.0) 0.0

Buff details

  • buff initial source:CoF+EEF
  • cooldown name:buff_finality_eviscerate
  • max_stacks:10
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.04

Stack Uptimes

  • finality_eviscerate_5:18.33%
  • finality_eviscerate_6:30.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:197496
  • name:Finality: Eviscerate
  • tooltip:Your next Eviscerate will do $w1% increased damage.
  • description:
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Finality: Nightblade 8.7 0.0 35.3sec 35.3sec 42.84% 40.44% 0.0(0.0) 0.0

Buff details

  • buff initial source:CoF+EEF
  • cooldown name:buff_finality_nightblade
  • max_stacks:6
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.04

Stack Uptimes

  • finality_nightblade_5:13.77%
  • finality_nightblade_6:29.08%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:197498
  • name:Finality: Nightblade
  • tooltip:Your next Nightblade will do $w1% increased damage.
  • description:
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Frost Enchant 1.2 0.1 106.5sec 88.7sec 8.14% 8.14% 0.1(0.1) 1.1

Buff details

  • buff initial source:CoF+EEF
  • cooldown name:buff_frost_enchant
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:4828.95

Stack Uptimes

  • frost_enchant_1:8.14%

Trigger Attempt Success

  • trigger_pct:74.25%

Spelldata details

  • id:225729
  • name:Frost Enchant
  • tooltip:Mastery increased by $w1.
  • description:{$@spelldesc225129=Your melee and ranged attacks have a chance to grant you a Fiery, Frost, or Arcane enchant for {$225726d=20 seconds}. }
  • max_stacks:0
  • duration:20.00
  • cooldown:1.00
  • default_chance:0.00%
Goremaw's Bite 4.6 0.0 64.1sec 64.1sec 9.11% 9.11% 27.4(27.4) 4.5

Buff details

  • buff initial source:CoF+EEF
  • cooldown name:buff_goremaws_bite
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • goremaws_bite_1:9.11%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:220901
  • name:Goremaw's Bite
  • tooltip:Generating {$s2=5} Energy every $t2 sec.
  • description:{$@spelldesc209782=Lashes out at the target, inflicting ${$209783sw2+$209784sw2} Shadow damage and reducing movement speed by {$209786s1=60}% for {$209786d=8 seconds}. Grants $220901o2 Energy over {$220901d=6 seconds}. |cFFFFFFFFAwards {$220901s1=3} combo $lpoint:points;.|r}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Master of Subtlety 38.7 1.6 7.8sec 7.5sec 34.89% 49.16% 1.6(1.6) 11.9

Buff details

  • buff initial source:CoF+EEF
  • cooldown name:buff_master_of_subtlety
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • master_of_subtlety_1:34.89%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:31223
  • name:Master of Subtlety
  • tooltip:
  • description:Attacks made while stealthed and for {$s1=5} seconds after breaking stealth cause an additional {$31665s1=10}% damage.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Master of Subtlety (_aura) 38.8 1.7 7.8sec 7.6sec 51.50% 34.74% 1.7(1.7) 0.0

Buff details

  • buff initial source:CoF+EEF
  • cooldown name:buff_master_of_subtlety_aura
  • max_stacks:1
  • duration:150.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • master_of_subtlety_aura_1:51.50%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:31223
  • name:Master of Subtlety
  • tooltip:
  • description:Attacks made while stealthed and for {$s1=5} seconds after breaking stealth cause an additional {$31665s1=10}% damage.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of the Old War 2.0 0.0 86.8sec 0.0sec 16.24% 16.24% 0.0(0.0) 2.0

Buff details

  • buff initial source:CoF+EEF
  • cooldown name:buff_potion_of_the_old_war
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_the_old_war_1:16.24%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188028
  • name:Potion of the Old War
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Shadow Blades 3.5 0.0 97.6sec 98.3sec 56.12% 60.57% 0.0(0.0) 3.1

Buff details

  • buff initial source:CoF+EEF
  • cooldown name:buff_shadow_blades
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • shadow_blades_1:56.12%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:121471
  • name:Shadow Blades
  • tooltip:Autoattacks deal pure Shadow damage. Combo-point-generating attacks generate {$s2=1} additional combo point.
  • description:Draws upon surrounding shadows to empower your weapons, causing auto attacks to deal Shadow damage and abilities that generate combo points to generate 1 additional combo point. Lasts {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Shadow Dance 28.3 0.0 10.7sec 10.7sec 46.73% 46.73% 0.0(0.0) 27.9

Buff details

  • buff initial source:CoF+EEF
  • cooldown name:buff_shadow_dance
  • max_stacks:1
  • duration:5.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • shadow_dance_1:46.73%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:185313
  • name:Shadow Dance
  • tooltip:
  • description:Allows use of all Stealth abilities and grants all the combat benefits of Stealth for {$d=3 seconds}. Effect not broken from taking damage or attacking. {$?s14062=false}[Movement speed while active is increased by {$1784s3=0}% and damage dealt is increased by {$1784s4=0}%. ]?s108209[Abilities cost {$112942s1=75}% less while active. ][]{$?s31223=false}[Attacks from Shadow Dance and for {$31223s1=5} sec after deal {$31665s1=10}% more damage. ][]
  • max_stacks:0
  • duration:3.00
  • cooldown:1.00
  • default_chance:0.00%
Sprint 2.7 0.0 122.5sec 122.5sec 7.20% 7.20% 86.7(86.7) 2.7

Buff details

  • buff initial source:CoF+EEF
  • cooldown name:buff_sprint
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • sprint_1:7.20%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2983
  • name:Sprint
  • tooltip:Movement speed increased by $w1%.
  • description:Increases your movement speed by {$s1=70}% for {$d=8 seconds}. Usable while stealthed.
  • max_stacks:0
  • duration:8.00
  • cooldown:120.00
  • default_chance:0.00%
Stealth 6.5 0.0 45.0sec 52.2sec 1.02% 1.02% 0.0(0.0) 0.0

Buff details

  • buff initial source:CoF+EEF
  • cooldown name:buff_stealth
  • max_stacks:1
  • duration:150.00
  • cooldown:2.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stealth_1:1.02%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:1784
  • name:Stealth
  • tooltip:Stealthed.$?$w3!=0[ Movement speed increased by $w3%.][]$?$w4!=0[ Damage increased by $w4%.][]
  • description:Conceals you in the shadows until cancelled, allowing you to stalk enemies without being seen. {$?s14062=false}[Movement speed while stealthed is increased by {$s3=0}% and damage dealt is increased by {$s4=0}%.]?s108209[ Abilities cost {$112942s1=75}% less while stealthed. ][]{$?s31223=false}[ Attacks from Stealth and for {$31223s1=5} sec after deal {$31665s1=10}% more damage.][]
  • max_stacks:0
  • duration:-0.00
  • cooldown:2.00
  • default_chance:100.00%
Subterfuge 6.6 0.0 44.7sec 52.3sec 6.54% 6.54% 0.0(0.0) 6.5

Buff details

  • buff initial source:CoF+EEF
  • cooldown name:buff_subterfuge
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • subterfuge_1:6.54%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:115192
  • name:Subterfuge
  • tooltip:Temporarily concealed in the shadows.
  • description:{$@spelldesc108208=Your abilities requiring Stealth can still be used for {$115192d=3 seconds} after Stealth breaks.$?c3[ Also increases the duration of Shadow Dance by ${$m2/1000} sec.][ Also causes Garrote to deal {$115192s2=125}% increased damage and have no cooldown when used from Stealth or {$115192d=3 seconds} after Stealth breaks.]}
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
Symbols of Death 1.1 13.1 194.4sec 22.1sec 99.88% 99.40% 13.1(13.1) 0.2

Buff details

  • buff initial source:CoF+EEF
  • cooldown name:buff_symbols_of_death
  • max_stacks:1
  • duration:35.00
  • cooldown:10.00
  • default_chance:100.00%
  • default_value:1.20

Stack Uptimes

  • symbols_of_death_1:99.88%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:212283
  • name:Symbols of Death
  • tooltip:All damage done increased by {$s1=20}%.
  • description:Invoke ancient symbols of power, increasing all damage you deal by {$s1=20}% for {$d=35 seconds}, and causing your next Shadowstrike to critically strike. Unaffected by the global cooldown.
  • max_stacks:0
  • duration:35.00
  • cooldown:10.00
  • default_chance:0.00%
Temptation 2.0 4.6 117.9sec 30.1sec 43.03% 67.71% 0.0(0.0) 1.7

Buff details

  • buff initial source:CoF+EEF
  • cooldown name:buff_temptation
  • max_stacks:10
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • temptation_1:10.76%
  • temptation_2:11.45%
  • temptation_3:11.92%
  • temptation_4:8.62%
  • temptation_5:0.23%
  • temptation_6:0.05%
  • temptation_7:0.02%
  • temptation_8:0.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:234143
  • name:Temptation
  • tooltip:Increased chance for your Ring of Collapsing Futures to incur a {$s1=5} min cooldown.
  • description:{$@spelldesc234142=Deal {$s1=40000} Shadow damage to an enemy.}
  • max_stacks:10
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Vanish 5.6 0.0 52.1sec 52.1sec 5.53% 5.53% 0.0(0.0) 5.5

Buff details

  • buff initial source:CoF+EEF
  • cooldown name:buff_vanish
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • vanish_1:5.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:11327
  • name:Vanish
  • tooltip:Improved stealth.$?$w3!=0[ Movement speed increased by $w3%.][]$?$w4!=0[ Damage increased by $w4%.][]
  • description:
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:CoF+EEF
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Seventh Demon

Buff details

  • buff initial source:CoF+EEF
  • cooldown name:buff_flask_of_the_seventh_demon
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:1300.00

Stack Uptimes

  • flask_of_the_seventh_demon_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188033
  • name:Flask of the Seventh Demon
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (seedbattered_fish_plate)

Buff details

  • buff initial source:CoF+EEF
  • cooldown name:buff_seedbattered_fish_plate
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:versatility_rating
  • amount:375.00

Stack Uptimes

  • seedbattered_fish_plate_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225605
  • name:Well Fed
  • tooltip:Versatility increased by $w1.
  • description:Increases versatility by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
CoF+EEF
backstab Energy 47.7 1668.0 35.0 35.0 4910.5
eviscerate Energy 59.5 2083.7 35.0 35.0 28705.2
eviscerate Combo Points 59.5 336.6 5.7 5.7 177714.9
nightblade Energy 17.0 426.2 25.0 25.0 87376.3
nightblade Combo Points 17.0 96.5 5.7 5.7 385869.9
shadowstrike Energy 112.0 4479.9 40.0 40.0 10749.7
symbols_of_death Energy 14.3 464.2 32.5 32.5 0.0
Resource Gains Type Count Total Average Overflow
backstab Combo Points 47.66 47.66 (10.93%) 1.00 0.00 0.00%
goremaws_bite Combo Points 4.63 13.68 (3.14%) 2.96 0.20 1.42%
shadowstrike Combo Points 112.00 224.00 (51.37%) 2.00 0.00 0.00%
energy_regen Energy 1102.15 3352.65 (36.99%) 3.04 111.61 3.22%
Shadow Techniques Combo Points 75.71 71.05 (16.29%) 0.94 19.92 21.90%
Master of Shadows Energy 39.41 805.23 (8.88%) 20.43 179.92 18.26%
Shadow Blades Combo Points 94.01 79.66 (18.27%) 0.85 14.36 15.27%
Energetic Stabbing Energy 27.87 696.74 (7.69%) 25.00 0.00 0.00%
Goremaw's Bite Energy 27.40 132.85 (1.47%) 4.85 4.16 3.04%
Relentless Strikes Energy 76.58 3404.62 (37.56%) 44.46 59.27 1.71%
Shadow Satyr's Walk Energy 112.00 671.99 (7.41%) 6.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Energy 30.09 30.28
Combo Points 1.45 1.44
Combat End Resource Mean Min Max
Energy 42.66 6.30 100.00
Combo Points 2.87 0.00 6.00

Benefits & Uptimes

Benefits %
Uptimes %
Energy Cap 1.8%

Statistics & Data Analysis

Fight Length
Sample Data CoF+EEF Fight Length
Count 4999
Mean 301.28
Minimum 222.03
Maximum 381.32
Spread ( max - min ) 159.29
Range [ ( max - min ) / 2 * 100% ] 26.44%
DPS
Sample Data CoF+EEF Damage Per Second
Count 4999
Mean 596428.80
Minimum 515283.45
Maximum 685524.79
Spread ( max - min ) 170241.34
Range [ ( max - min ) / 2 * 100% ] 14.27%
Standard Deviation 22674.7222
5th Percentile 560661.14
95th Percentile 634408.62
( 95th Percentile - 5th Percentile ) 73747.48
Mean Distribution
Standard Deviation 320.7011
95.00% Confidence Intervall ( 595800.24 - 597057.36 )
Normalized 95.00% Confidence Intervall ( 99.89% - 100.11% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 56
0.1% Error 5553
0.1 Scale Factor Error with Delta=300 4389021
0.05 Scale Factor Error with Delta=300 17556083
0.01 Scale Factor Error with Delta=300 438902061
Priority Target DPS
Sample Data CoF+EEF Priority Target Damage Per Second
Count 4999
Mean 596428.80
Minimum 515283.45
Maximum 685524.79
Spread ( max - min ) 170241.34
Range [ ( max - min ) / 2 * 100% ] 14.27%
Standard Deviation 22674.7222
5th Percentile 560661.14
95th Percentile 634408.62
( 95th Percentile - 5th Percentile ) 73747.48
Mean Distribution
Standard Deviation 320.7011
95.00% Confidence Intervall ( 595800.24 - 597057.36 )
Normalized 95.00% Confidence Intervall ( 99.89% - 100.11% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 56
0.1% Error 5553
0.1 Scale Factor Error with Delta=300 4389021
0.05 Scale Factor Error with Delta=300 17556083
0.01 Scale Factor Error with Delta=300 438902061
DPS(e)
Sample Data CoF+EEF Damage Per Second (Effective)
Count 4999
Mean 596428.80
Minimum 515283.45
Maximum 685524.79
Spread ( max - min ) 170241.34
Range [ ( max - min ) / 2 * 100% ] 14.27%
Damage
Sample Data CoF+EEF Damage
Count 4999
Mean 179281880.96
Minimum 129759867.63
Maximum 232315837.57
Spread ( max - min ) 102555969.94
Range [ ( max - min ) / 2 * 100% ] 28.60%
DTPS
Sample Data CoF+EEF Damage Taken Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data CoF+EEF Healing Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data CoF+EEF Healing Per Second (Effective)
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data CoF+EEF Heal
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data CoF+EEF Healing Taken Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data CoF+EEF Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data CoF+EEFTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data CoF+EEF Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,name=flask_of_the_seventh_demon
1 0.00 augmentation,name=defiled
2 0.00 food,name=seedbattered_fish_plate
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 stealth
5 0.00 potion,name=old_war
6 0.00 marked_for_death,if=raid_event.adds.in>40
7 0.00 variable,name=ssw_refund,value=equipped.shadow_satyrs_walk*(4+ssw_refund_offset)
Defined variables that doesn't change during the fight
8 0.00 variable,name=stealth_threshold,value=(15+talent.vigor.enabled*35+talent.master_of_shadows.enabled*30+variable.ssw_refund)
9 0.00 enveloping_shadows,if=combo_points>=5
A 0.00 symbols_of_death
Default action list Executed every time the actor is available.
# count action,conditions
B 0.00 call_action_list,name=cds
C 0.00 run_action_list,name=stealthed,if=stealthed.all
Fully switch to the Stealthed Rotation (by doing so, it forces pooling if nothing is available)
D 0.00 call_action_list,name=finish,if=combo_points>=5|(combo_points>=4&spell_targets.shuriken_storm>=3&spell_targets.shuriken_storm<=4)
E 0.00 call_action_list,name=stealth_als,if=combo_points.deficit>=2+talent.premeditation.enabled
F 0.00 call_action_list,name=build,if=energy.deficit<=variable.stealth_threshold
actions.build Builders
# count action,conditions
0.00 shuriken_storm,if=spell_targets.shuriken_storm>=2
0.00 gloomblade
G 47.66 backstab
actions.cds Cooldowns
# count action,conditions
H 1.00 potion,name=old_war,if=buff.bloodlust.react|target.time_to_die<=25|buff.shadow_blades.up
I 6.64 use_item,slot=finger2,if=(buff.shadow_blades.up&stealthed.rogue)|target.time_to_die<20
0.00 blood_fury,if=stealthed.rogue
0.00 berserking,if=stealthed.rogue
0.00 arcane_torrent,if=stealthed.rogue&energy.deficit>70
J 3.55 shadow_blades,if=combo_points<=2|(equipped.denial_of_the_halfgiants&combo_points>=1)
K 4.63 goremaws_bite,if=!stealthed.all&cooldown.shadow_dance.charges_fractional<=2.45&((combo_points.deficit>=4-(time<10)*2&energy.deficit>50+talent.vigor.enabled*25-(time>=10)*15)|target.time_to_die<8)
0.00 marked_for_death,target_if=min:target.time_to_die,if=target.time_to_die<combo_points.deficit|(raid_event.adds.in>40&combo_points.deficit>=4+talent.deeper_strategem.enabled+talent.anticipation.enabled)
actions.finish Finishers
# count action,conditions
0.00 enveloping_shadows,if=buff.enveloping_shadows.remains<target.time_to_die&buff.enveloping_shadows.remains<=combo_points*1.8
0.00 death_from_above,if=spell_targets.death_from_above>=6
L 17.05 nightblade,cycle_targets=1,if=target.time_to_die>8&((refreshable&(!finality|buff.finality_nightblade.up))|remains<tick_time)
0.00 death_from_above
M 59.53 eviscerate
actions.stealth_cds Stealth Cooldowns
# count action,conditions
R 3.71 shadow_dance,if=charges_fractional>=2.45
S 2.85 vanish
T 2.74 sprint_offensive
U 4.63 shadow_dance,if=charges>=2&combo_points<=1
0.00 pool_resource,for_next=1,extra_amount=40
0.00 shadowmeld,if=energy>=40&energy.deficit>=10+variable.ssw_refund
V 19.97 shadow_dance,if=combo_points<=1
actions.stealthed Stealthed Rotation
# count action,conditions
W 13.26 symbols_of_death,if=(buff.symbols_of_death.remains<target.time_to_die-4&buff.symbols_of_death.remains<=buff.symbols_of_death.duration*0.3)|equipped.shadow_satyrs_walk&energy.time_to_max<0.25
X 0.00 call_action_list,name=finish,if=combo_points>=5
0.00 shuriken_storm,if=buff.shadowmeld.down&((combo_points.deficit>=3&spell_targets.shuriken_storm>=2+talent.premeditation.enabled+equipped.shadow_satyrs_walk)|buff.the_dreadlords_deceit.stack>=29)
Y 112.00 shadowstrike

Sample Sequence

0124578AJIYYLRYYMYYMGGMRWYYMIYYLGSYMYMRWYYMYYMGTGMRIYWYMYYLUYYMYYMUYYMIYYMUWYYLYYMVYYMYYMVWYYYMKGMVYYYLWYGJHMGGMVIYYLYMGGMVYYMYYMGGMVIYYMYGLGGMVWYIMYGGLKGMVYYYMYSWYMYGGGLVYYMYTGMYYGLVWYYMYGMJGMVIYYLYYMVYYMYYMGGLKGMVIWYYMYGMVYYMYYMGGLVIYYMYYMVYYMYYLGGGGMVWYYMYGLGGKMVYYMYYMSYYYLVWYYYMTGGGJYMYGMVYYMYYMGG

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask CoF+EEF 100.0/100: 100% energy | 0.0/6: 0% combo_points
Pre precombat 1 augmentation CoF+EEF 100.0/100: 100% energy | 0.0/6: 0% combo_points
Pre precombat 2 food CoF+EEF 100.0/100: 100% energy | 0.0/6: 0% combo_points
Pre precombat 4 stealth Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, stealth
Pre precombat 5 potion Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, stealth, potion_of_the_old_war
Pre precombat 7 ssw_refund Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, stealth, potion_of_the_old_war
Pre precombat 8 stealth_threshold Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, stealth, potion_of_the_old_war
Pre precombat A symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, stealth, symbols_of_death, death, potion_of_the_old_war
0:00.000 cds J shadow_blades Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, stealth, symbols_of_death, death, potion_of_the_old_war
0:00.000 cds I use_item_ring_of_collapsing_futures Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, stealth, symbols_of_death, shadow_blades, death, potion_of_the_old_war
0:00.000 stealthed Y shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points temptation, master_of_subtlety_aura, stealth, symbols_of_death, shadow_blades, death, potion_of_the_old_war
0:01.003 stealthed Y shadowstrike Fluffy_Pillow 80.3/100: 80% energy | 3.0/6: 50% combo_points bloodlust, temptation, master_of_subtlety_aura, stealth, subterfuge, symbols_of_death, shadow_blades, potion_of_the_old_war
0:02.008 finish L nightblade Fluffy_Pillow 85.6/100: 86% energy | 6.0/6: 100% combo_points bloodlust, temptation, master_of_subtlety_aura, stealth, subterfuge, symbols_of_death, shadow_blades, potion_of_the_old_war
0:03.013 stealth_cds R shadow_dance Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points bloodlust, temptation, master_of_subtlety, symbols_of_death, shadow_blades, finality_nightblade(6), potion_of_the_old_war
0:03.013 stealthed Y shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points bloodlust, temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6), potion_of_the_old_war
0:04.017 stealthed Y shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 3.0/6: 50% combo_points bloodlust, temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6), potion_of_the_old_war
0:05.021 finish M eviscerate Fluffy_Pillow 80.3/100: 80% energy | 6.0/6: 100% combo_points bloodlust, temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6), potion_of_the_old_war
0:06.027 stealthed Y shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points bloodlust, temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6), potion_of_the_old_war
0:07.033 stealthed Y shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 4.0/6: 67% combo_points bloodlust, temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6), potion_of_the_old_war
0:08.036 finish M eviscerate Fluffy_Pillow 80.3/100: 80% energy | 6.0/6: 100% combo_points bloodlust, temptation, master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6), potion_of_the_old_war
0:09.040 build G backstab Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points bloodlust, temptation, master_of_subtlety, symbols_of_death, shadow_blades, finality_nightblade(6), potion_of_the_old_war
0:10.045 build G backstab Fluffy_Pillow 79.3/100: 79% energy | 4.0/6: 67% combo_points bloodlust, temptation, master_of_subtlety, symbols_of_death, shadow_blades, finality_nightblade(6), potion_of_the_old_war
0:11.049 finish M eviscerate Fluffy_Pillow 58.6/100: 59% energy | 6.0/6: 100% combo_points bloodlust, temptation, master_of_subtlety, symbols_of_death, shadow_blades, finality_nightblade(6), potion_of_the_old_war
0:12.053 stealth_cds R shadow_dance Fluffy_Pillow 77.9/100: 78% energy | 1.0/6: 17% combo_points bloodlust, temptation, master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6), potion_of_the_old_war
0:12.053 stealthed W symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points bloodlust, temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6), potion_of_the_old_war
0:12.053 stealthed Y shadowstrike Fluffy_Pillow 65.0/100: 65% energy | 1.0/6: 17% combo_points bloodlust, temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, death, finality_eviscerate(6), finality_nightblade(6), potion_of_the_old_war
0:13.059 stealthed Y shadowstrike Fluffy_Pillow 70.3/100: 70% energy | 4.0/6: 67% combo_points bloodlust, temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6), potion_of_the_old_war
0:14.063 finish M eviscerate Fluffy_Pillow 50.6/100: 51% energy | 6.0/6: 100% combo_points bloodlust, temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6), potion_of_the_old_war
0:15.068 cds I use_item_ring_of_collapsing_futures Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points bloodlust, temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6), potion_of_the_old_war
0:15.068 stealthed Y shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points bloodlust, temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6), potion_of_the_old_war
0:16.074 stealthed Y shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 4.0/6: 67% combo_points bloodlust, temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6), potion_of_the_old_war
0:17.081 finish L nightblade Fluffy_Pillow 80.3/100: 80% energy | 6.0/6: 100% combo_points bloodlust, temptation(2), master_of_subtlety, symbols_of_death, shadow_blades, finality_nightblade(6), potion_of_the_old_war
0:18.087 build G backstab Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points bloodlust, temptation(2), master_of_subtlety, symbols_of_death, shadow_blades, potion_of_the_old_war
0:19.093 stealth_cds S vanish Fluffy_Pillow 79.3/100: 79% energy | 2.0/6: 33% combo_points bloodlust, temptation(2), master_of_subtlety, symbols_of_death, shadow_blades, potion_of_the_old_war
0:19.093 stealthed Y shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 2.0/6: 33% combo_points bloodlust, temptation(2), master_of_subtlety_aura, vanish, symbols_of_death, shadow_blades, potion_of_the_old_war
0:20.096 finish M eviscerate Fluffy_Pillow 100.0/100: 100% energy | 5.0/6: 83% combo_points bloodlust, temptation(2), master_of_subtlety_aura, vanish, subterfuge, symbols_of_death, shadow_blades, potion_of_the_old_war
0:21.100 stealthed Y shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 2.0/6: 33% combo_points bloodlust, temptation(2), master_of_subtlety_aura, vanish, subterfuge, symbols_of_death, shadow_blades, finality_eviscerate(5), potion_of_the_old_war
0:22.105 finish M eviscerate Fluffy_Pillow 100.0/100: 100% energy | 5.0/6: 83% combo_points bloodlust, temptation(2), master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(5), potion_of_the_old_war
0:23.109 stealth_cds R shadow_dance Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points bloodlust, temptation(2), master_of_subtlety, symbols_of_death, shadow_blades
0:23.109 stealthed W symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points bloodlust, temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades
0:23.109 stealthed Y shadowstrike Fluffy_Pillow 65.0/100: 65% energy | 0.0/6: 0% combo_points bloodlust, temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, death
0:24.114 stealthed Y shadowstrike Fluffy_Pillow 45.3/100: 45% energy | 3.0/6: 50% combo_points bloodlust, temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades
0:25.119 Waiting     0.700 sec 25.6/100: 26% energy | 6.0/6: 100% combo_points bloodlust, temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades
0:25.819 finish M eviscerate Fluffy_Pillow 35.6/100: 36% energy | 6.0/6: 100% combo_points bloodlust, temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades
0:26.822 stealthed Y shadowstrike Fluffy_Pillow 94.9/100: 95% energy | 1.0/6: 17% combo_points bloodlust, temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6)
0:27.827 stealthed Y shadowstrike Fluffy_Pillow 75.2/100: 75% energy | 4.0/6: 67% combo_points bloodlust, temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6)
0:28.830 finish M eviscerate Fluffy_Pillow 55.5/100: 55% energy | 6.0/6: 100% combo_points bloodlust, temptation(2), master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6)
0:29.835 build G backstab Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points bloodlust, temptation(2), master_of_subtlety, symbols_of_death, shadow_blades
0:30.839 stealth_cds T sprint Fluffy_Pillow 79.3/100: 79% energy | 3.0/6: 50% combo_points bloodlust, temptation(2), master_of_subtlety, symbols_of_death, shadow_blades
0:30.839 build G backstab Fluffy_Pillow 79.3/100: 79% energy | 3.0/6: 50% combo_points bloodlust, temptation(2), master_of_subtlety, sprint, symbols_of_death, shadow_blades, faster_than_light_trigger
0:31.845 finish M eviscerate Fluffy_Pillow 58.6/100: 59% energy | 5.0/6: 83% combo_points bloodlust, temptation(2), master_of_subtlety, sprint, symbols_of_death, shadow_blades, faster_than_light_trigger
0:32.849 stealth_cds R shadow_dance Fluffy_Pillow 77.9/100: 78% energy | 0.0/6: 0% combo_points bloodlust, temptation(2), master_of_subtlety, sprint, symbols_of_death, shadow_blades, finality_eviscerate(5), faster_than_light_trigger
0:32.849 cds I use_item_ring_of_collapsing_futures Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points bloodlust, temptation(2), master_of_subtlety_aura, shadow_dance, sprint, symbols_of_death, shadow_blades, finality_eviscerate(5), faster_than_light_trigger
0:32.849 stealthed Y shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points bloodlust, temptation(3), master_of_subtlety_aura, shadow_dance, sprint, symbols_of_death, shadow_blades, finality_eviscerate(5), faster_than_light_trigger
0:33.855 stealthed W symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 3.0/6: 50% combo_points bloodlust, temptation(3), master_of_subtlety_aura, shadow_dance, vanish, subterfuge, sprint, symbols_of_death, shadow_blades, finality_eviscerate(5)
0:33.855 stealthed Y shadowstrike Fluffy_Pillow 65.0/100: 65% energy | 3.0/6: 50% combo_points bloodlust, temptation(3), master_of_subtlety_aura, shadow_dance, vanish, subterfuge, sprint, symbols_of_death, shadow_blades, death, finality_eviscerate(5)
0:34.858 finish M eviscerate Fluffy_Pillow 45.3/100: 45% energy | 6.0/6: 100% combo_points bloodlust, temptation(3), master_of_subtlety_aura, shadow_dance, vanish, subterfuge, sprint, symbols_of_death, shadow_blades, finality_eviscerate(5)
0:35.862 stealthed Y shadowstrike Fluffy_Pillow 64.6/100: 65% energy | 1.0/6: 17% combo_points bloodlust, temptation(3), master_of_subtlety_aura, shadow_dance, vanish, subterfuge, sprint, symbols_of_death, shadow_blades
0:36.865 stealthed Y shadowstrike Fluffy_Pillow 69.9/100: 70% energy | 4.0/6: 67% combo_points bloodlust, temptation(3), master_of_subtlety, shadow_dance, sprint, symbols_of_death, shadow_blades
0:37.870 finish L nightblade Fluffy_Pillow 50.2/100: 50% energy | 6.0/6: 100% combo_points bloodlust, temptation(3), master_of_subtlety, sprint, symbols_of_death, shadow_blades
0:38.875 stealth_cds U shadow_dance Fluffy_Pillow 79.5/100: 79% energy | 0.0/6: 0% combo_points bloodlust, temptation(3), master_of_subtlety, symbols_of_death, shadow_blades, finality_nightblade(6)
0:38.875 stealthed Y shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points bloodlust, temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6)
0:39.880 stealthed Y shadowstrike Fluffy_Pillow 80.3/100: 80% energy | 3.0/6: 50% combo_points bloodlust, temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6)
0:40.884 finish M eviscerate Fluffy_Pillow 85.6/100: 86% energy | 6.0/6: 100% combo_points bloodlust, temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6)
0:41.889 stealthed Y shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6)
0:42.892 stealthed Y shadowstrike Fluffy_Pillow 77.0/100: 77% energy | 3.0/6: 50% combo_points temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6)
0:43.897 finish M eviscerate Fluffy_Pillow 54.0/100: 54% energy | 6.0/6: 100% combo_points temptation(3), master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6)
0:44.903 stealth_cds U shadow_dance Fluffy_Pillow 70.0/100: 70% energy | 0.0/6: 0% combo_points temptation(3), master_of_subtlety, symbols_of_death, shadow_blades, finality_nightblade(6)
0:44.903 stealthed Y shadowstrike Fluffy_Pillow 95.0/100: 95% energy | 0.0/6: 0% combo_points temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6)
0:45.908 stealthed Y shadowstrike Fluffy_Pillow 72.0/100: 72% energy | 3.0/6: 50% combo_points temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6)
0:46.915 finish M eviscerate Fluffy_Pillow 49.1/100: 49% energy | 6.0/6: 100% combo_points temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6)
0:47.920 cds I use_item_ring_of_collapsing_futures Fluffy_Pillow 65.1/100: 65% energy | 0.0/6: 0% combo_points temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6)
0:47.920 stealthed Y shadowstrike Fluffy_Pillow 65.1/100: 65% energy | 0.0/6: 0% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6)
0:48.924 stealthed Y shadowstrike Fluffy_Pillow 67.1/100: 67% energy | 3.0/6: 50% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6)
0:49.930 finish M eviscerate Fluffy_Pillow 69.1/100: 69% energy | 6.0/6: 100% combo_points temptation(4), master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6)
0:50.933 stealth_cds U shadow_dance Fluffy_Pillow 85.1/100: 85% energy | 0.0/6: 0% combo_points temptation(4), master_of_subtlety, symbols_of_death, shadow_blades, finality_nightblade(6)
0:50.933 stealthed W symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6)
0:50.933 stealthed Y shadowstrike Fluffy_Pillow 65.0/100: 65% energy | 0.0/6: 0% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, death, finality_nightblade(6)
0:51.937 stealthed Y shadowstrike Fluffy_Pillow 42.0/100: 42% energy | 4.0/6: 67% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6)
0:52.942 finish L nightblade Fluffy_Pillow 44.0/100: 44% energy | 6.0/6: 100% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6)
0:53.944 stealthed Y shadowstrike Fluffy_Pillow 70.0/100: 70% energy | 0.0/6: 0% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades
0:54.950 stealthed Y shadowstrike Fluffy_Pillow 47.0/100: 47% energy | 4.0/6: 67% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades
0:55.953 Waiting     1.100 sec 24.0/100: 24% energy | 6.0/6: 100% combo_points temptation(4), master_of_subtlety, symbols_of_death, shadow_blades
0:57.053 finish M eviscerate Fluffy_Pillow 36.0/100: 36% energy | 6.0/6: 100% combo_points temptation(4), master_of_subtlety, symbols_of_death
0:58.058 stealth_cds V shadow_dance Fluffy_Pillow 92.1/100: 92% energy | 1.0/6: 17% combo_points temptation(4), master_of_subtlety, symbols_of_death, finality_eviscerate(6)
0:58.058 stealthed Y shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6)
0:59.062 stealthed Y shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 3.0/6: 50% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6)
1:00.065 finish M eviscerate Fluffy_Pillow 77.0/100: 77% energy | 5.0/6: 83% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6)
1:01.070 stealthed Y shadowstrike Fluffy_Pillow 93.0/100: 93% energy | 0.0/6: 0% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death
1:02.074 stealthed Y shadowstrike Fluffy_Pillow 95.0/100: 95% energy | 2.0/6: 33% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death
1:03.078 finish M eviscerate Fluffy_Pillow 97.0/100: 97% energy | 5.0/6: 83% combo_points temptation(4), master_of_subtlety, symbols_of_death
1:04.084 stealth_cds V shadow_dance Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points temptation(4), master_of_subtlety, symbols_of_death, finality_eviscerate(5)
1:04.084 stealthed W symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5)
1:04.084 stealthed Y shadowstrike Fluffy_Pillow 65.0/100: 65% energy | 0.0/6: 0% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death, death, finality_eviscerate(5)
1:05.088 stealthed Y shadowstrike Fluffy_Pillow 42.0/100: 42% energy | 2.0/6: 33% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5)
1:06.094 stealthed Y shadowstrike Fluffy_Pillow 44.0/100: 44% energy | 4.0/6: 67% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5)
1:07.098 Waiting     1.363 sec 21.0/100: 21% energy | 6.0/6: 100% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5)
1:08.461 finish M eviscerate Fluffy_Pillow 35.9/100: 36% energy | 6.0/6: 100% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5)
1:09.466 cds K goremaws_bite Fluffy_Pillow 52.0/100: 52% energy | 0.0/6: 0% combo_points temptation(4), master_of_subtlety, symbols_of_death
1:10.471 build G backstab Fluffy_Pillow 68.0/100: 68% energy | 3.0/6: 50% combo_points temptation(4), master_of_subtlety, symbols_of_death, goremaws_bite
1:11.473 finish M eviscerate Fluffy_Pillow 48.9/100: 49% energy | 5.0/6: 83% combo_points temptation(4), master_of_subtlety, symbols_of_death, goremaws_bite
1:12.478 stealth_cds V shadow_dance Fluffy_Pillow 70.0/100: 70% energy | 0.0/6: 0% combo_points temptation(4), master_of_subtlety, symbols_of_death, goremaws_bite, finality_eviscerate(5)
1:12.478 stealthed Y shadowstrike Fluffy_Pillow 95.0/100: 95% energy | 0.0/6: 0% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death, goremaws_bite, finality_eviscerate(5)
1:13.481 stealthed Y shadowstrike Fluffy_Pillow 76.9/100: 77% energy | 2.0/6: 33% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death, goremaws_bite, finality_eviscerate(5)
1:14.486 stealthed Y shadowstrike Fluffy_Pillow 84.0/100: 84% energy | 4.0/6: 67% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death, goremaws_bite, finality_eviscerate(5)
1:15.490 finish L nightblade Fluffy_Pillow 91.0/100: 91% energy | 6.0/6: 100% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5)
1:16.496 stealthed W symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5), finality_nightblade(6)
1:16.496 stealthed Y shadowstrike Fluffy_Pillow 65.0/100: 65% energy | 0.0/6: 0% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death, death, finality_eviscerate(5), finality_nightblade(6)
1:17.501 Waiting     0.900 sec 42.0/100: 42% energy | 2.0/6: 33% combo_points temptation(4), master_of_subtlety, symbols_of_death, finality_eviscerate(5), finality_nightblade(6)
1:18.401 build G backstab Fluffy_Pillow 51.9/100: 52% energy | 3.0/6: 50% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5), finality_nightblade(6)
1:19.403 Waiting     0.400 sec 27.8/100: 28% energy | 4.0/6: 67% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5), finality_nightblade(6)
1:19.803 cds J shadow_blades Fluffy_Pillow 32.2/100: 32% energy | 4.0/6: 67% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5), finality_nightblade(6)
1:20.000 cds H potion Fluffy_Pillow 34.4/100: 34% energy | 4.0/6: 67% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(5), finality_nightblade(6)
1:20.000 Waiting     1.000 sec 34.4/100: 34% energy | 4.0/6: 67% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(5), finality_nightblade(6), potion_of_the_old_war
1:21.000 finish M eviscerate Fluffy_Pillow 45.3/100: 45% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(5), finality_nightblade(6), potion_of_the_old_war
1:22.003 build G backstab Fluffy_Pillow 61.3/100: 61% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_nightblade(6), potion_of_the_old_war
1:23.006 Waiting     1.300 sec 37.3/100: 37% energy | 2.0/6: 33% combo_points symbols_of_death, shadow_blades, finality_nightblade(6), potion_of_the_old_war
1:24.306 build G backstab Fluffy_Pillow 51.6/100: 52% energy | 3.0/6: 50% combo_points symbols_of_death, shadow_blades, finality_nightblade(6), potion_of_the_old_war
1:25.310 Waiting     0.700 sec 27.6/100: 28% energy | 5.0/6: 83% combo_points symbols_of_death, shadow_blades, finality_nightblade(6), potion_of_the_old_war
1:26.010 finish M eviscerate Fluffy_Pillow 35.2/100: 35% energy | 5.0/6: 83% combo_points symbols_of_death, shadow_blades, finality_nightblade(6), potion_of_the_old_war
1:27.014 stealth_cds V shadow_dance Fluffy_Pillow 51.2/100: 51% energy | 0.0/6: 0% combo_points symbols_of_death, shadow_blades, finality_eviscerate(5), finality_nightblade(6), potion_of_the_old_war
1:27.014 cds I use_item_ring_of_collapsing_futures Fluffy_Pillow 76.2/100: 76% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(5), finality_nightblade(6), potion_of_the_old_war
1:27.014 stealthed Y shadowstrike Fluffy_Pillow 76.2/100: 76% energy | 0.0/6: 0% combo_points temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(5), finality_nightblade(6), potion_of_the_old_war
1:28.018 stealthed Y shadowstrike Fluffy_Pillow 78.2/100: 78% energy | 4.0/6: 67% combo_points temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(5), finality_nightblade(6), potion_of_the_old_war
1:29.022 finish L nightblade Fluffy_Pillow 55.2/100: 55% energy | 6.0/6: 100% combo_points temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(5), finality_nightblade(6), potion_of_the_old_war
1:30.027 stealthed Y shadowstrike Fluffy_Pillow 81.2/100: 81% energy | 0.0/6: 0% combo_points temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(5), potion_of_the_old_war
1:31.032 finish M eviscerate Fluffy_Pillow 58.2/100: 58% energy | 5.0/6: 83% combo_points temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(5), potion_of_the_old_war
1:32.035 build G backstab Fluffy_Pillow 74.2/100: 74% energy | 0.0/6: 0% combo_points temptation, master_of_subtlety, symbols_of_death, shadow_blades, potion_of_the_old_war
1:33.041 Waiting     0.100 sec 50.2/100: 50% energy | 2.0/6: 33% combo_points temptation, master_of_subtlety, symbols_of_death, shadow_blades, potion_of_the_old_war
1:33.141 build G backstab Fluffy_Pillow 51.3/100: 51% energy | 2.0/6: 33% combo_points temptation, master_of_subtlety, symbols_of_death, shadow_blades, potion_of_the_old_war
1:34.146 Waiting     1.700 sec 27.4/100: 27% energy | 4.0/6: 67% combo_points temptation, master_of_subtlety, symbols_of_death, shadow_blades, potion_of_the_old_war
1:35.846 finish M eviscerate Fluffy_Pillow 46.0/100: 46% energy | 5.0/6: 83% combo_points temptation, master_of_subtlety, symbols_of_death, shadow_blades, potion_of_the_old_war
1:36.849 stealth_cds V shadow_dance Fluffy_Pillow 62.0/100: 62% energy | 0.0/6: 0% combo_points temptation, master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(5), potion_of_the_old_war
1:36.849 stealthed Y shadowstrike Fluffy_Pillow 87.0/100: 87% energy | 0.0/6: 0% combo_points temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(5), potion_of_the_old_war
1:37.853 stealthed Y shadowstrike Fluffy_Pillow 89.0/100: 89% energy | 3.0/6: 50% combo_points temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(5), potion_of_the_old_war
1:38.858 finish M eviscerate Fluffy_Pillow 66.0/100: 66% energy | 6.0/6: 100% combo_points temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(5), potion_of_the_old_war
1:39.862 stealthed Y shadowstrike Fluffy_Pillow 82.0/100: 82% energy | 1.0/6: 17% combo_points temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, potion_of_the_old_war
1:40.864 stealthed Y shadowstrike Fluffy_Pillow 58.9/100: 59% energy | 4.0/6: 67% combo_points temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, potion_of_the_old_war
1:41.868 finish M eviscerate Fluffy_Pillow 60.9/100: 61% energy | 6.0/6: 100% combo_points temptation, master_of_subtlety, symbols_of_death, shadow_blades, potion_of_the_old_war
1:42.874 build G backstab Fluffy_Pillow 77.0/100: 77% energy | 0.0/6: 0% combo_points temptation, master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), potion_of_the_old_war
1:43.877 build G backstab Fluffy_Pillow 53.0/100: 53% energy | 2.0/6: 33% combo_points temptation, master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), potion_of_the_old_war
1:44.882 Waiting     0.600 sec 29.0/100: 29% energy | 6.0/6: 100% combo_points temptation, master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), potion_of_the_old_war
1:45.482 finish M eviscerate Fluffy_Pillow 35.5/100: 36% energy | 6.0/6: 100% combo_points temptation, master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6)
1:46.485 stealth_cds V shadow_dance Fluffy_Pillow 51.5/100: 52% energy | 0.0/6: 0% combo_points temptation, master_of_subtlety, symbols_of_death, shadow_blades
1:46.485 cds I use_item_ring_of_collapsing_futures Fluffy_Pillow 76.5/100: 77% energy | 0.0/6: 0% combo_points temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades
1:46.485 stealthed Y shadowstrike Fluffy_Pillow 76.5/100: 77% energy | 0.0/6: 0% combo_points temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades
1:47.489 stealthed Y shadowstrike Fluffy_Pillow 53.5/100: 54% energy | 4.0/6: 67% combo_points temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades
1:48.493 Waiting     0.500 sec 30.5/100: 31% energy | 6.0/6: 100% combo_points temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades
1:48.993 finish M eviscerate Fluffy_Pillow 36.0/100: 36% energy | 6.0/6: 100% combo_points temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades
1:49.996 stealthed Y shadowstrike Fluffy_Pillow 52.0/100: 52% energy | 0.0/6: 0% combo_points temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6)
1:51.000 Waiting     2.100 sec 29.0/100: 29% energy | 3.0/6: 50% combo_points temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6)
1:53.100 build G backstab Fluffy_Pillow 52.0/100: 52% energy | 4.0/6: 67% combo_points temptation(2), master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6)
1:54.103 finish L nightblade Fluffy_Pillow 28.0/100: 28% energy | 6.0/6: 100% combo_points temptation(2), master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), fiery_enchant
1:55.106 build G backstab Fluffy_Pillow 54.0/100: 54% energy | 0.0/6: 0% combo_points temptation(2), master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6), fiery_enchant
1:56.112 Waiting     2.000 sec 30.0/100: 30% energy | 4.0/6: 67% combo_points temptation(2), master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6), fiery_enchant
1:58.112 build G backstab Fluffy_Pillow 51.9/100: 52% energy | 4.0/6: 67% combo_points temptation(2), symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6), fiery_enchant
1:59.117 Waiting     0.700 sec 27.9/100: 28% energy | 6.0/6: 100% combo_points temptation(2), symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6), fiery_enchant
1:59.817 finish M eviscerate Fluffy_Pillow 35.6/100: 36% energy | 6.0/6: 100% combo_points temptation(2), symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6), fiery_enchant
2:00.822 stealth_cds V shadow_dance Fluffy_Pillow 51.6/100: 52% energy | 1.0/6: 17% combo_points temptation(2), symbols_of_death, shadow_blades, finality_nightblade(6), fiery_enchant
2:00.822 stealthed W symbols_of_death Fluffy_Pillow 76.6/100: 77% energy | 1.0/6: 17% combo_points temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6), fiery_enchant
2:00.822 stealthed Y shadowstrike Fluffy_Pillow 41.6/100: 42% energy | 1.0/6: 17% combo_points temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, death, finality_nightblade(6), fiery_enchant
2:01.825 cds I use_item_ring_of_collapsing_futures Fluffy_Pillow 18.6/100: 19% energy | 4.0/6: 67% combo_points temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6), fiery_enchant
2:01.825 Waiting     1.886 sec 18.6/100: 19% energy | 4.0/6: 67% combo_points temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6), fiery_enchant
2:03.711 finish M eviscerate Fluffy_Pillow 39.2/100: 39% energy | 5.0/6: 83% combo_points temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(6), fiery_enchant
2:04.717 stealthed Y shadowstrike Fluffy_Pillow 55.3/100: 55% energy | 0.0/6: 0% combo_points temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5), finality_nightblade(6), fiery_enchant
2:05.723 Waiting     1.800 sec 32.3/100: 32% energy | 2.0/6: 33% combo_points temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5), finality_nightblade(6), fiery_enchant
2:07.523 build G backstab Fluffy_Pillow 52.0/100: 52% energy | 2.0/6: 33% combo_points temptation(3), master_of_subtlety, symbols_of_death, finality_eviscerate(5), finality_nightblade(6), fiery_enchant
2:08.529 Waiting     2.100 sec 28.0/100: 28% energy | 3.0/6: 50% combo_points temptation(3), master_of_subtlety, symbols_of_death, finality_eviscerate(5), finality_nightblade(6), fiery_enchant
2:10.629 build G backstab Fluffy_Pillow 51.0/100: 51% energy | 4.0/6: 67% combo_points temptation(3), master_of_subtlety, symbols_of_death, finality_eviscerate(5), finality_nightblade(6), fiery_enchant
2:11.634 finish L nightblade Fluffy_Pillow 27.0/100: 27% energy | 5.0/6: 83% combo_points temptation(3), symbols_of_death, finality_eviscerate(5), finality_nightblade(6), fiery_enchant
2:12.638 cds K goremaws_bite Fluffy_Pillow 53.0/100: 53% energy | 0.0/6: 0% combo_points temptation(3), symbols_of_death, finality_eviscerate(5), fiery_enchant
2:13.642 build G backstab Fluffy_Pillow 69.0/100: 69% energy | 4.0/6: 67% combo_points temptation(3), symbols_of_death, goremaws_bite, finality_eviscerate(5), fiery_enchant
2:14.647 finish M eviscerate Fluffy_Pillow 50.0/100: 50% energy | 5.0/6: 83% combo_points temptation(3), symbols_of_death, goremaws_bite, finality_eviscerate(5)
2:15.652 stealth_cds V shadow_dance Fluffy_Pillow 71.1/100: 71% energy | 0.0/6: 0% combo_points temptation(3), symbols_of_death, goremaws_bite
2:15.652 stealthed Y shadowstrike Fluffy_Pillow 96.1/100: 96% energy | 0.0/6: 0% combo_points temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, goremaws_bite
2:16.657 stealthed Y shadowstrike Fluffy_Pillow 78.1/100: 78% energy | 2.0/6: 33% combo_points temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, goremaws_bite
2:17.661 stealthed Y shadowstrike Fluffy_Pillow 60.1/100: 60% energy | 4.0/6: 67% combo_points temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, goremaws_bite
2:18.663 finish M eviscerate Fluffy_Pillow 67.0/100: 67% energy | 6.0/6: 100% combo_points temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death
2:19.666 stealthed Y shadowstrike Fluffy_Pillow 83.0/100: 83% energy | 0.0/6: 0% combo_points temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6)
2:20.671 stealth_cds S vanish Fluffy_Pillow 85.0/100: 85% energy | 2.0/6: 33% combo_points temptation(3), master_of_subtlety, symbols_of_death, finality_eviscerate(6)
2:20.671 stealthed W symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 2.0/6: 33% combo_points temptation(3), master_of_subtlety_aura, vanish, symbols_of_death, finality_eviscerate(6)
2:20.671 stealthed Y shadowstrike Fluffy_Pillow 65.0/100: 65% energy | 2.0/6: 33% combo_points temptation(3), master_of_subtlety_aura, vanish, symbols_of_death, death, finality_eviscerate(6)
2:21.675 finish M eviscerate Fluffy_Pillow 67.0/100: 67% energy | 5.0/6: 83% combo_points temptation(3), master_of_subtlety_aura, vanish, subterfuge, symbols_of_death, finality_eviscerate(6)
2:22.682 stealthed Y shadowstrike Fluffy_Pillow 83.0/100: 83% energy | 0.0/6: 0% combo_points temptation(3), master_of_subtlety_aura, vanish, subterfuge, symbols_of_death
2:23.688 build G backstab Fluffy_Pillow 85.1/100: 85% energy | 2.0/6: 33% combo_points temptation(3), master_of_subtlety, symbols_of_death
2:24.693 build G backstab Fluffy_Pillow 61.1/100: 61% energy | 3.0/6: 50% combo_points temptation(3), master_of_subtlety, symbols_of_death
2:25.699 Waiting     1.300 sec 37.1/100: 37% energy | 4.0/6: 67% combo_points temptation(3), master_of_subtlety, symbols_of_death
2:26.999 build G backstab Fluffy_Pillow 51.3/100: 51% energy | 4.0/6: 67% combo_points temptation(3), master_of_subtlety, symbols_of_death
2:28.004 finish L nightblade Fluffy_Pillow 27.3/100: 27% energy | 5.0/6: 83% combo_points temptation(3), master_of_subtlety, symbols_of_death
2:29.009 stealth_cds V shadow_dance Fluffy_Pillow 53.3/100: 53% energy | 1.0/6: 17% combo_points temptation(3), symbols_of_death, finality_nightblade(5)
2:29.009 stealthed Y shadowstrike Fluffy_Pillow 78.3/100: 78% energy | 1.0/6: 17% combo_points temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(5)
2:30.014 stealthed Y shadowstrike Fluffy_Pillow 55.4/100: 55% energy | 3.0/6: 50% combo_points temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(5)
2:31.018 Waiting     0.300 sec 32.4/100: 32% energy | 5.0/6: 83% combo_points temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(5)
2:31.318 finish M eviscerate Fluffy_Pillow 35.6/100: 36% energy | 5.0/6: 83% combo_points temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(5)
2:32.321 stealthed Y shadowstrike Fluffy_Pillow 51.6/100: 52% energy | 1.0/6: 17% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5), finality_nightblade(5)
2:33.326 Waiting     0.700 sec 28.6/100: 29% energy | 3.0/6: 50% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5), finality_nightblade(5)
2:34.026 stealth_cds T sprint Fluffy_Pillow 36.3/100: 36% energy | 3.0/6: 50% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5), finality_nightblade(5)
2:34.026 Waiting     1.400 sec 36.3/100: 36% energy | 3.0/6: 50% combo_points master_of_subtlety, sprint, symbols_of_death, finality_eviscerate(5), finality_nightblade(5), faster_than_light_trigger
2:35.426 build G backstab Fluffy_Pillow 51.6/100: 52% energy | 3.0/6: 50% combo_points master_of_subtlety, sprint, symbols_of_death, finality_eviscerate(5), finality_nightblade(5), faster_than_light_trigger
2:36.429 Waiting     0.600 sec 27.6/100: 28% energy | 4.0/6: 67% combo_points master_of_subtlety, sprint, symbols_of_death, finality_eviscerate(5), finality_nightblade(5), faster_than_light_trigger
2:37.029 finish M eviscerate Fluffy_Pillow 59.2/100: 59% energy | 5.0/6: 83% combo_points master_of_subtlety_aura, vanish, subterfuge, sprint, symbols_of_death, finality_eviscerate(5), finality_nightblade(5)
2:38.033 stealthed Y shadowstrike Fluffy_Pillow 75.2/100: 75% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, vanish, subterfuge, sprint, symbols_of_death, finality_nightblade(5)
2:39.038 stealthed Y shadowstrike Fluffy_Pillow 77.2/100: 77% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, vanish, subterfuge, sprint, symbols_of_death, finality_nightblade(5)
2:40.042 build G backstab Fluffy_Pillow 100.0/100: 100% energy | 4.0/6: 67% combo_points master_of_subtlety, sprint, symbols_of_death, finality_nightblade(5)
2:41.047 finish L nightblade Fluffy_Pillow 76.0/100: 76% energy | 5.0/6: 83% combo_points master_of_subtlety, sprint, symbols_of_death, finality_nightblade(5)
2:42.051 stealth_cds V shadow_dance Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death
2:42.051 stealthed W symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
2:42.051 stealthed Y shadowstrike Fluffy_Pillow 65.0/100: 65% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, death
2:43.054 stealthed Y shadowstrike Fluffy_Pillow 42.0/100: 42% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
2:44.059 Waiting     1.547 sec 19.0/100: 19% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
2:45.606 finish M eviscerate Fluffy_Pillow 35.9/100: 36% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
2:46.610 stealthed Y shadowstrike Fluffy_Pillow 51.9/100: 52% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6)
2:47.614 Waiting     2.100 sec 28.9/100: 29% energy | 2.0/6: 33% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(6)
2:49.714 build G backstab Fluffy_Pillow 51.9/100: 52% energy | 4.0/6: 67% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(6)
2:50.717 Waiting     0.700 sec 27.9/100: 28% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(6)
2:51.417 finish M eviscerate Fluffy_Pillow 35.6/100: 36% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(6)
2:52.422 cds J shadow_blades Fluffy_Pillow 51.6/100: 52% energy | 2.0/6: 33% combo_points symbols_of_death
2:52.422 build G backstab Fluffy_Pillow 51.6/100: 52% energy | 2.0/6: 33% combo_points symbols_of_death, shadow_blades
2:53.427 Waiting     1.700 sec 27.6/100: 28% energy | 4.0/6: 67% combo_points symbols_of_death, shadow_blades
2:55.127 finish M eviscerate Fluffy_Pillow 46.2/100: 46% energy | 5.0/6: 83% combo_points symbols_of_death, shadow_blades
2:56.131 stealth_cds V shadow_dance Fluffy_Pillow 62.2/100: 62% energy | 0.0/6: 0% combo_points symbols_of_death, shadow_blades, finality_eviscerate(5)
2:56.131 cds I use_item_ring_of_collapsing_futures Fluffy_Pillow 87.2/100: 87% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(5)
2:56.131 stealthed Y shadowstrike Fluffy_Pillow 87.2/100: 87% energy | 0.0/6: 0% combo_points temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(5)
2:57.137 stealthed Y shadowstrike Fluffy_Pillow 64.3/100: 64% energy | 3.0/6: 50% combo_points temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(5)
2:58.140 finish L nightblade Fluffy_Pillow 41.3/100: 41% energy | 6.0/6: 100% combo_points temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(5)
2:59.144 stealthed Y shadowstrike Fluffy_Pillow 67.3/100: 67% energy | 0.0/6: 0% combo_points temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(5), finality_nightblade(6)
3:00.150 stealthed Y shadowstrike Fluffy_Pillow 44.3/100: 44% energy | 4.0/6: 67% combo_points temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(5), finality_nightblade(6)
3:01.155 Waiting     1.339 sec 21.3/100: 21% energy | 6.0/6: 100% combo_points temptation, master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(5), finality_nightblade(6)
3:02.494 finish M eviscerate Fluffy_Pillow 36.0/100: 36% energy | 6.0/6: 100% combo_points temptation, master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(5), finality_nightblade(6)
3:03.498 stealth_cds V shadow_dance Fluffy_Pillow 52.0/100: 52% energy | 1.0/6: 17% combo_points temptation, master_of_subtlety, symbols_of_death, shadow_blades, finality_nightblade(6)
3:03.498 stealthed Y shadowstrike Fluffy_Pillow 77.0/100: 77% energy | 1.0/6: 17% combo_points temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6)
3:04.501 stealthed Y shadowstrike Fluffy_Pillow 53.9/100: 54% energy | 4.0/6: 67% combo_points temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6)
3:05.505 finish M eviscerate Fluffy_Pillow 55.9/100: 56% energy | 6.0/6: 100% combo_points temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6)
3:06.509 stealthed Y shadowstrike Fluffy_Pillow 71.9/100: 72% energy | 0.0/6: 0% combo_points temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6)
3:07.514 stealthed Y shadowstrike Fluffy_Pillow 48.9/100: 49% energy | 4.0/6: 67% combo_points temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6)
3:08.516 finish M eviscerate Fluffy_Pillow 50.9/100: 51% energy | 6.0/6: 100% combo_points temptation, master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6)
3:09.521 build G backstab Fluffy_Pillow 66.9/100: 67% energy | 0.0/6: 0% combo_points temptation, master_of_subtlety, symbols_of_death, shadow_blades, finality_nightblade(6)
3:10.525 Waiting     0.800 sec 42.9/100: 43% energy | 2.0/6: 33% combo_points temptation, master_of_subtlety, symbols_of_death, shadow_blades, finality_nightblade(6)
3:11.325 build G backstab Fluffy_Pillow 51.7/100: 52% energy | 2.0/6: 33% combo_points temptation, master_of_subtlety, symbols_of_death, shadow_blades, finality_nightblade(6)
3:12.327 Waiting     0.400 sec 27.7/100: 28% energy | 6.0/6: 100% combo_points temptation, master_of_subtlety, symbols_of_death, shadow_blades, finality_nightblade(6)
3:12.727 finish L nightblade Fluffy_Pillow 32.1/100: 32% energy | 6.0/6: 100% combo_points temptation, master_of_subtlety, symbols_of_death, shadow_blades, finality_nightblade(6)
3:13.732 cds K goremaws_bite Fluffy_Pillow 58.1/100: 58% energy | 0.0/6: 0% combo_points temptation, symbols_of_death, shadow_blades
3:14.736 build G backstab Fluffy_Pillow 74.1/100: 74% energy | 3.0/6: 50% combo_points temptation, symbols_of_death, shadow_blades, goremaws_bite
3:15.740 finish M eviscerate Fluffy_Pillow 55.1/100: 55% energy | 6.0/6: 100% combo_points temptation, symbols_of_death, shadow_blades, goremaws_bite
3:16.745 stealth_cds V shadow_dance Fluffy_Pillow 76.1/100: 76% energy | 0.0/6: 0% combo_points temptation, symbols_of_death, shadow_blades, goremaws_bite, finality_eviscerate(6)
3:16.745 cds I use_item_ring_of_collapsing_futures Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, goremaws_bite, finality_eviscerate(6)
3:16.745 stealthed W symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, goremaws_bite, finality_eviscerate(6)
3:16.745 stealthed Y shadowstrike Fluffy_Pillow 65.0/100: 65% energy | 0.0/6: 0% combo_points temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, goremaws_bite, death, finality_eviscerate(6)
3:17.749 stealthed Y shadowstrike Fluffy_Pillow 47.0/100: 47% energy | 3.0/6: 50% combo_points temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, goremaws_bite, finality_eviscerate(6)
3:18.753 Waiting     0.600 sec 29.0/100: 29% energy | 6.0/6: 100% combo_points temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, goremaws_bite, finality_eviscerate(6)
3:19.353 finish M eviscerate Fluffy_Pillow 35.6/100: 36% energy | 6.0/6: 100% combo_points temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, goremaws_bite, finality_eviscerate(6)
3:20.358 stealthed Y shadowstrike Fluffy_Pillow 56.6/100: 57% energy | 0.0/6: 0% combo_points temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades
3:21.363 Waiting     1.600 sec 33.6/100: 34% energy | 3.0/6: 50% combo_points temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades
3:22.963 build G backstab Fluffy_Pillow 51.1/100: 51% energy | 4.0/6: 67% combo_points temptation(2), master_of_subtlety, symbols_of_death, shadow_blades
3:23.968 Waiting     0.800 sec 27.1/100: 27% energy | 6.0/6: 100% combo_points temptation(2), master_of_subtlety, symbols_of_death, shadow_blades
3:24.768 finish M eviscerate Fluffy_Pillow 35.9/100: 36% energy | 6.0/6: 100% combo_points temptation(2), master_of_subtlety, symbols_of_death, shadow_blades
3:25.773 stealth_cds V shadow_dance Fluffy_Pillow 51.9/100: 52% energy | 0.0/6: 0% combo_points temptation(2), master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6)
3:25.773 stealthed Y shadowstrike Fluffy_Pillow 76.9/100: 77% energy | 0.0/6: 0% combo_points temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6)
3:26.778 stealthed Y shadowstrike Fluffy_Pillow 78.9/100: 79% energy | 3.0/6: 50% combo_points temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6)
3:27.782 finish M eviscerate Fluffy_Pillow 55.9/100: 56% energy | 6.0/6: 100% combo_points temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6)
3:28.786 stealthed Y shadowstrike Fluffy_Pillow 71.9/100: 72% energy | 0.0/6: 0% combo_points temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades
3:29.788 stealthed Y shadowstrike Fluffy_Pillow 48.9/100: 49% energy | 4.0/6: 67% combo_points temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades
3:30.789 Waiting     0.900 sec 25.9/100: 26% energy | 6.0/6: 100% combo_points temptation(2), master_of_subtlety, symbols_of_death, shadow_blades
3:31.689 finish M eviscerate Fluffy_Pillow 35.7/100: 36% energy | 6.0/6: 100% combo_points temptation(2), master_of_subtlety, symbols_of_death, shadow_blades
3:32.697 build G backstab Fluffy_Pillow 51.8/100: 52% energy | 0.0/6: 0% combo_points temptation(2), master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6)
3:33.701 Waiting     2.000 sec 27.8/100: 28% energy | 4.0/6: 67% combo_points temptation(2), master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6)
3:35.701 build G backstab Fluffy_Pillow 51.2/100: 51% energy | 4.0/6: 67% combo_points temptation(2), master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), arcane_enchant
3:36.706 finish L nightblade Fluffy_Pillow 28.5/100: 29% energy | 6.0/6: 100% combo_points temptation(2), symbols_of_death, shadow_blades, finality_eviscerate(6), arcane_enchant
3:37.710 stealth_cds V shadow_dance Fluffy_Pillow 55.8/100: 56% energy | 0.0/6: 0% combo_points temptation(2), symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6), arcane_enchant
3:37.710 cds I use_item_ring_of_collapsing_futures Fluffy_Pillow 80.8/100: 81% energy | 0.0/6: 0% combo_points temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6), arcane_enchant
3:37.710 stealthed Y shadowstrike Fluffy_Pillow 80.8/100: 81% energy | 0.0/6: 0% combo_points temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6), arcane_enchant
3:38.714 stealthed Y shadowstrike Fluffy_Pillow 59.2/100: 59% energy | 3.0/6: 50% combo_points temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6), finality_nightblade(6), arcane_enchant
3:39.718 finish M eviscerate Fluffy_Pillow 37.5/100: 37% energy | 6.0/6: 100% combo_points temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6), finality_nightblade(6), arcane_enchant
3:40.722 stealthed Y shadowstrike Fluffy_Pillow 54.8/100: 55% energy | 0.0/6: 0% combo_points temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(6), arcane_enchant
3:41.727 Waiting     0.600 sec 33.1/100: 33% energy | 2.0/6: 33% combo_points temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(6), arcane_enchant
3:42.327 stealthed Y shadowstrike Fluffy_Pillow 40.5/100: 40% energy | 2.0/6: 33% combo_points temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(6), arcane_enchant
3:43.331 Waiting     1.404 sec 18.8/100: 19% energy | 4.0/6: 67% combo_points temptation(3), master_of_subtlety, symbols_of_death, finality_nightblade(6), arcane_enchant
3:44.735 finish M eviscerate Fluffy_Pillow 36.0/100: 36% energy | 5.0/6: 83% combo_points temptation(3), master_of_subtlety, symbols_of_death, finality_nightblade(6), arcane_enchant
3:45.741 stealth_cds V shadow_dance Fluffy_Pillow 53.4/100: 53% energy | 0.0/6: 0% combo_points temptation(3), master_of_subtlety, symbols_of_death, finality_eviscerate(5), finality_nightblade(6), arcane_enchant
3:45.741 stealthed Y shadowstrike Fluffy_Pillow 78.4/100: 78% energy | 0.0/6: 0% combo_points temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5), finality_nightblade(6), arcane_enchant
3:46.746 stealthed Y shadowstrike Fluffy_Pillow 56.7/100: 57% energy | 3.0/6: 50% combo_points temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5), finality_nightblade(6), arcane_enchant
3:47.750 finish M eviscerate Fluffy_Pillow 35.0/100: 35% energy | 5.0/6: 83% combo_points temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5), finality_nightblade(6), arcane_enchant
3:48.754 stealthed Y shadowstrike Fluffy_Pillow 52.3/100: 52% energy | 0.0/6: 0% combo_points temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(6), arcane_enchant
3:49.759 Waiting     0.800 sec 30.7/100: 31% energy | 2.0/6: 33% combo_points temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(6), arcane_enchant
3:50.559 stealthed Y shadowstrike Fluffy_Pillow 40.5/100: 40% energy | 2.0/6: 33% combo_points temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(6), arcane_enchant
3:51.563 Waiting     0.600 sec 43.8/100: 44% energy | 4.0/6: 67% combo_points temptation(3), master_of_subtlety, symbols_of_death, finality_nightblade(6), arcane_enchant
3:52.163 finish L nightblade Fluffy_Pillow 51.2/100: 51% energy | 5.0/6: 83% combo_points temptation(3), master_of_subtlety, symbols_of_death, finality_nightblade(6), arcane_enchant
3:53.167 build G backstab Fluffy_Pillow 78.5/100: 78% energy | 0.0/6: 0% combo_points temptation(3), master_of_subtlety, symbols_of_death, arcane_enchant
3:54.171 build G backstab Fluffy_Pillow 55.8/100: 56% energy | 1.0/6: 17% combo_points temptation(3), master_of_subtlety, symbols_of_death, arcane_enchant
3:55.177 Waiting     1.500 sec 33.1/100: 33% energy | 2.0/6: 33% combo_points temptation(3), master_of_subtlety, symbols_of_death, arcane_enchant
3:56.677 build G backstab Fluffy_Pillow 51.5/100: 52% energy | 2.0/6: 33% combo_points temptation(3), symbols_of_death, arcane_enchant
3:57.682 Waiting     1.900 sec 28.9/100: 29% energy | 3.0/6: 50% combo_points temptation(3), symbols_of_death, arcane_enchant
3:59.582 build G backstab Fluffy_Pillow 52.2/100: 52% energy | 4.0/6: 67% combo_points temptation(3), symbols_of_death, arcane_enchant
4:00.588 Waiting     0.500 sec 29.5/100: 30% energy | 5.0/6: 83% combo_points temptation(3), symbols_of_death, arcane_enchant
4:01.088 finish M eviscerate Fluffy_Pillow 35.7/100: 36% energy | 5.0/6: 83% combo_points temptation(3), symbols_of_death, arcane_enchant
4:02.091 stealth_cds V shadow_dance Fluffy_Pillow 53.0/100: 53% energy | 0.0/6: 0% combo_points temptation(3), symbols_of_death, finality_eviscerate(5), arcane_enchant
4:02.091 stealthed W symbols_of_death Fluffy_Pillow 78.0/100: 78% energy | 0.0/6: 0% combo_points temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5), arcane_enchant
4:02.091 stealthed Y shadowstrike Fluffy_Pillow 43.0/100: 43% energy | 0.0/6: 0% combo_points temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, death, finality_eviscerate(5), arcane_enchant
4:03.095 stealthed Y shadowstrike Fluffy_Pillow 46.3/100: 46% energy | 4.0/6: 67% combo_points temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5), arcane_enchant
4:04.100 Waiting     0.900 sec 24.6/100: 25% energy | 6.0/6: 100% combo_points temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5), arcane_enchant
4:05.000 finish M eviscerate Fluffy_Pillow 35.7/100: 36% energy | 6.0/6: 100% combo_points temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5), arcane_enchant
4:06.005 stealthed Y shadowstrike Fluffy_Pillow 53.0/100: 53% energy | 0.0/6: 0% combo_points temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, arcane_enchant
4:07.012 Waiting     1.700 sec 31.3/100: 31% energy | 3.0/6: 50% combo_points temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, arcane_enchant
4:08.712 build G backstab Fluffy_Pillow 52.2/100: 52% energy | 3.0/6: 50% combo_points master_of_subtlety, symbols_of_death, arcane_enchant
4:09.718 Waiting     0.100 sec 29.5/100: 30% energy | 4.0/6: 67% combo_points master_of_subtlety, symbols_of_death, arcane_enchant
4:09.818 finish L nightblade Fluffy_Pillow 30.8/100: 31% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death, arcane_enchant
4:10.821 build G backstab Fluffy_Pillow 58.1/100: 58% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, finality_nightblade(5), arcane_enchant
4:11.828 Waiting     1.400 sec 35.4/100: 35% energy | 1.0/6: 17% combo_points master_of_subtlety, symbols_of_death, finality_nightblade(5), arcane_enchant
4:13.228 build G backstab Fluffy_Pillow 51.2/100: 51% energy | 1.0/6: 17% combo_points symbols_of_death, finality_nightblade(5)
4:14.232 cds K goremaws_bite Fluffy_Pillow 27.2/100: 27% energy | 2.0/6: 33% combo_points symbols_of_death, finality_nightblade(5)
4:15.235 finish M eviscerate Fluffy_Pillow 43.2/100: 43% energy | 6.0/6: 100% combo_points symbols_of_death, goremaws_bite, finality_nightblade(5)
4:16.239 stealth_cds V shadow_dance Fluffy_Pillow 64.1/100: 64% energy | 0.0/6: 0% combo_points symbols_of_death, goremaws_bite, finality_eviscerate(6), finality_nightblade(5)
4:16.239 stealthed Y shadowstrike Fluffy_Pillow 89.1/100: 89% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, goremaws_bite, finality_eviscerate(6), finality_nightblade(5)
4:17.244 stealthed Y shadowstrike Fluffy_Pillow 71.2/100: 71% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, goremaws_bite, finality_eviscerate(6), finality_nightblade(5)
4:18.248 finish M eviscerate Fluffy_Pillow 53.2/100: 53% energy | 5.0/6: 83% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, goremaws_bite, finality_eviscerate(6), finality_nightblade(5)
4:19.253 stealthed Y shadowstrike Fluffy_Pillow 74.2/100: 74% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, goremaws_bite, finality_nightblade(5)
4:20.256 stealthed Y shadowstrike Fluffy_Pillow 56.2/100: 56% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(5)
4:21.261 Waiting     0.200 sec 33.2/100: 33% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death, finality_nightblade(5)
4:21.461 finish M eviscerate Fluffy_Pillow 35.4/100: 35% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death, finality_nightblade(5)
4:22.464 stealth_cds S vanish Fluffy_Pillow 51.3/100: 51% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5), finality_nightblade(5)
4:22.464 stealthed Y shadowstrike Fluffy_Pillow 76.3/100: 76% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, vanish, symbols_of_death, finality_eviscerate(5), finality_nightblade(5)
4:23.469 stealthed Y shadowstrike Fluffy_Pillow 53.4/100: 53% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, vanish, subterfuge, symbols_of_death, finality_eviscerate(5), finality_nightblade(5)
4:24.473 stealthed Y shadowstrike Fluffy_Pillow 55.4/100: 55% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, vanish, subterfuge, symbols_of_death, finality_eviscerate(5), finality_nightblade(5)
4:25.476 finish L nightblade Fluffy_Pillow 57.3/100: 57% energy | 6.0/6: 100% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5), finality_nightblade(5)
4:26.480 stealth_cds V shadow_dance Fluffy_Pillow 83.3/100: 83% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5)
4:26.480 stealthed W symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5)
4:26.480 stealthed Y shadowstrike Fluffy_Pillow 65.0/100: 65% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, death, finality_eviscerate(5)
4:27.484 stealthed Y shadowstrike Fluffy_Pillow 42.0/100: 42% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5)
4:28.489 Waiting     1.946 sec 19.0/100: 19% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5)
4:30.435 stealthed Y shadowstrike Fluffy_Pillow 40.3/100: 40% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5)
4:31.440 Waiting     1.699 sec 17.3/100: 17% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5)
4:33.139 finish M eviscerate Fluffy_Pillow 35.9/100: 36% energy | 6.0/6: 100% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5)
4:34.143 stealth_cds T sprint Fluffy_Pillow 91.9/100: 92% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death
4:34.143 build G backstab Fluffy_Pillow 91.9/100: 92% energy | 0.0/6: 0% combo_points master_of_subtlety, sprint, symbols_of_death, faster_than_light_trigger
4:35.149 build G backstab Fluffy_Pillow 68.0/100: 68% energy | 1.0/6: 17% combo_points master_of_subtlety, sprint, symbols_of_death, faster_than_light_trigger
4:36.153 Waiting     0.700 sec 44.0/100: 44% energy | 2.0/6: 33% combo_points master_of_subtlety, sprint, symbols_of_death, faster_than_light_trigger
4:36.853 build G backstab Fluffy_Pillow 51.6/100: 52% energy | 2.0/6: 33% combo_points sprint, symbols_of_death, faster_than_light_trigger
4:37.857 cds J shadow_blades Fluffy_Pillow 52.6/100: 53% energy | 3.0/6: 50% combo_points master_of_subtlety_aura, vanish, subterfuge, sprint, symbols_of_death
4:37.857 stealthed Y shadowstrike Fluffy_Pillow 52.6/100: 53% energy | 3.0/6: 50% combo_points master_of_subtlety_aura, vanish, subterfuge, sprint, symbols_of_death, shadow_blades
4:38.861 finish M eviscerate Fluffy_Pillow 54.6/100: 55% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, vanish, subterfuge, sprint, symbols_of_death, shadow_blades
4:39.867 stealthed Y shadowstrike Fluffy_Pillow 70.7/100: 71% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, vanish, subterfuge, sprint, symbols_of_death, shadow_blades, finality_eviscerate(6)
4:40.871 build G backstab Fluffy_Pillow 72.7/100: 73% energy | 3.0/6: 50% combo_points master_of_subtlety, sprint, symbols_of_death, shadow_blades, finality_eviscerate(6)
4:41.875 finish M eviscerate Fluffy_Pillow 48.7/100: 49% energy | 5.0/6: 83% combo_points master_of_subtlety, sprint, symbols_of_death, shadow_blades, finality_eviscerate(6)
4:42.880 stealth_cds V shadow_dance Fluffy_Pillow 64.7/100: 65% energy | 1.0/6: 17% combo_points master_of_subtlety, symbols_of_death, shadow_blades
4:42.880 stealthed Y shadowstrike Fluffy_Pillow 89.7/100: 90% energy | 1.0/6: 17% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades
4:43.885 stealthed Y shadowstrike Fluffy_Pillow 66.7/100: 67% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades
4:44.890 finish M eviscerate Fluffy_Pillow 43.7/100: 44% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades
4:45.894 stealthed Y shadowstrike Fluffy_Pillow 59.7/100: 60% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6)
4:46.898 stealthed Y shadowstrike Fluffy_Pillow 61.7/100: 62% energy | 3.0/6: 50% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6)
4:47.904 finish M eviscerate Fluffy_Pillow 38.7/100: 39% energy | 6.0/6: 100% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6)
4:48.909 build G backstab Fluffy_Pillow 54.7/100: 55% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, shadow_blades
4:49.913 Waiting     1.900 sec 30.7/100: 31% energy | 2.0/6: 33% combo_points master_of_subtlety, symbols_of_death, shadow_blades
4:51.813 build G backstab Fluffy_Pillow 51.5/100: 52% energy | 3.0/6: 50% combo_points master_of_subtlety, symbols_of_death, shadow_blades
4:52.818 Waiting     0.700 sec 27.5/100: 28% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death, shadow_blades

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 8806 8481 0
Agility 32993 31287 20768 (15276)
Stamina 48391 48391 28183
Intellect 5325 5000 0
Spirit 0 0 0
Health 2903460 2903460 0
Energy 100 100 0
Combo Points 6 6 0
Crit 23.64% 23.64% 5456
Haste 9.55% 9.55% 3581
Damage / Heal Versatility 9.03% 8.23% 3909
Attack Power 32993 31287 0
Mastery 80.81% 80.81% 8510
Armor 2297 2297 2297
Run Speed 8 0 0

Gear

Source Slot Average Item Level: 891.00
Local Head Cowl of Fright
ilevel: 885, stats: { 300 Armor, +2829 Sta, +1886 AgiInt, +1015 Mastery, +547 Crit, +1076 unknown }
Local Neck Sea Fan Pendant
ilevel: 880, stats: { +1519 Sta, +1633 Vers, +965 Mastery }, enchant: mark_of_the_hidden_satyr
Local Shoulders Steelgazer Hide Mantle
ilevel: 880, stats: { 273 Armor, +1351 AgiInt, +2027 Sta, +673 Haste, +476 Vers, +771 unknown }
Local Shirt Common Gray Shirt
ilevel: 1
Local Chest Biornskin Vest
ilevel: 890, stats: { 376 Armor, +1977 AgiInt, +2965 Sta, +1034 Crit, +557 Mastery }
Local Waist Strand of Whelk Shells
ilevel: 880, stats: { 205 Armor, +2026 Sta, +1351 AgiInt, +673 Haste, +476 Mastery }, gems: { +150 Mastery }
Local Legs Legwraps of Unworthy Souls
ilevel: 880, stats: { 318 Armor, +2701 Sta, +1801 AgiInt, +964 Mastery, +570 Haste }
Local Feet Shadow Satyr's Walk
ilevel: 910, stats: { 276 Armor, +2680 Sta, +1786 Agi, +827 Haste, +459 Mastery }
Local Wrists Denial of the Half-Giants
ilevel: 910, stats: { 176 Armor, +2010 Sta, +1340 Agi, +276 Crit, +689 Mastery }
Local Hands Cruel Vice Grips
ilevel: 885, stats: { 231 Armor, +2122 Sta, +1415 AgiInt, +686 Crit, +485 Mastery }
Local Finger1 Grubby Silver Ring
ilevel: 880, stats: { +1519 Sta, +1484 Crit, +1114 Vers }, gems: { +150 Vers }, enchant: { +200 Mastery }
Local Finger2 Ring of Collapsing Futures
ilevel: 870, stats: { +1385 Sta, +1677 Mastery, +768 Haste, +419 Avoidance }, enchant: { +200 Vers }
Local Trinket1 Convergence of Fates
ilevel: 910, stats: { +2264 StrAgi }
Local Trinket2 Entwined Elemental Foci
ilevel: 910, stats: { +2264 StrAgi }
Local Back Drape of the Mana-Starved
ilevel: 875, stats: { 142 Armor, +1450 Sta, +967 StrAgiInt, +586 Crit, +259 Vers }, gems: { +200 Agi }, enchant: { +200 Agi }
Local Main Hand Fangs of the Devourer
ilevel: 906, weapon: { 3844 - 7140, 1.8 }, stats: { +983 Agi, +1475 Sta, +368 Crit, +353 Mastery }, relics: { +53 ilevels, +51 ilevels, +52 ilevels }
Local Off Hand Fangs of the Devourer
ilevel: 906, weapon: { 3844 - 7140, 1.8 }, stats: { +983 Agi, +1475 Sta, +368 Crit, +353 Mastery }

Talents

Level
15 Master of Subtlety (Subtlety Rogue) Weaponmaster (Subtlety Rogue) Gloomblade (Subtlety Rogue)
30 Nightstalker Subterfuge Shadow Focus
45 Deeper Stratagem Anticipation Vigor
60 Soothing Darkness (Subtlety Rogue) Elusiveness Cheat Death
75 Strike from the Shadows (Subtlety Rogue) Prey on the Weak Tangled Shadow (Subtlety Rogue)
90 Premeditation (Subtlety Rogue) Alacrity Enveloping Shadows (Subtlety Rogue)
100 Master of Shadows (Subtlety Rogue) Marked for Death Death from Above

Profile

rogue="CoF+EEF"
origin="https://eu.api.battle.net/wow/character/dalaran/Esdeåth/advanced"
level=110
race=human
role=attack
position=back
professions=alchemy=800/enchanting=133
talents=1210011
artifact=17:0:0:0:0:851:1:852:3:853:3:854:3:855:3:856:3:857:3:858:3:859:3:860:3:861:1:862:1:863:1:864:1:865:1:866:1:1349:1:1386:14
spec=subtlety

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,name=flask_of_the_seventh_demon
actions.precombat+=/augmentation,name=defiled
actions.precombat+=/food,name=seedbattered_fish_plate
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/stealth
actions.precombat+=/potion,name=old_war
actions.precombat+=/marked_for_death,if=raid_event.adds.in>40
# Defined variables that doesn't change during the fight
actions.precombat+=/variable,name=ssw_refund,value=equipped.shadow_satyrs_walk*(4+ssw_refund_offset)
actions.precombat+=/variable,name=stealth_threshold,value=(15+talent.vigor.enabled*35+talent.master_of_shadows.enabled*30+variable.ssw_refund)
actions.precombat+=/enveloping_shadows,if=combo_points>=5
actions.precombat+=/symbols_of_death

# Executed every time the actor is available.
actions=call_action_list,name=cds
# Fully switch to the Stealthed Rotation (by doing so, it forces pooling if nothing is available)
actions+=/run_action_list,name=stealthed,if=stealthed.all
actions+=/call_action_list,name=finish,if=combo_points>=5|(combo_points>=4&spell_targets.shuriken_storm>=3&spell_targets.shuriken_storm<=4)
actions+=/call_action_list,name=stealth_als,if=combo_points.deficit>=2+talent.premeditation.enabled
actions+=/call_action_list,name=build,if=energy.deficit<=variable.stealth_threshold

# Builders
actions.build=shuriken_storm,if=spell_targets.shuriken_storm>=2
actions.build+=/gloomblade
actions.build+=/backstab

# Cooldowns
actions.cds=potion,name=old_war,if=buff.bloodlust.react|target.time_to_die<=25|buff.shadow_blades.up
actions.cds+=/use_item,slot=finger2,if=(buff.shadow_blades.up&stealthed.rogue)|target.time_to_die<20
actions.cds+=/blood_fury,if=stealthed.rogue
actions.cds+=/berserking,if=stealthed.rogue
actions.cds+=/arcane_torrent,if=stealthed.rogue&energy.deficit>70
actions.cds+=/shadow_blades,if=combo_points<=2|(equipped.denial_of_the_halfgiants&combo_points>=1)
actions.cds+=/goremaws_bite,if=!stealthed.all&cooldown.shadow_dance.charges_fractional<=2.45&((combo_points.deficit>=4-(time<10)*2&energy.deficit>50+talent.vigor.enabled*25-(time>=10)*15)|target.time_to_die<8)
actions.cds+=/marked_for_death,target_if=min:target.time_to_die,if=target.time_to_die<combo_points.deficit|(raid_event.adds.in>40&combo_points.deficit>=4+talent.deeper_strategem.enabled+talent.anticipation.enabled)

# Finishers
actions.finish=enveloping_shadows,if=buff.enveloping_shadows.remains<target.time_to_die&buff.enveloping_shadows.remains<=combo_points*1.8
actions.finish+=/death_from_above,if=spell_targets.death_from_above>=6
actions.finish+=/nightblade,cycle_targets=1,if=target.time_to_die>8&((refreshable&(!finality|buff.finality_nightblade.up))|remains<tick_time)
actions.finish+=/death_from_above
actions.finish+=/eviscerate

# Stealth Action List Starter
actions.stealth_als=call_action_list,name=stealth_cds,if=energy.deficit<=variable.stealth_threshold&(!equipped.shadow_satyrs_walk|cooldown.shadow_dance.charges_fractional>=2.45|energy.deficit>=10)
actions.stealth_als+=/call_action_list,name=stealth_cds,if=spell_targets.shuriken_storm>=5
actions.stealth_als+=/call_action_list,name=stealth_cds,if=(cooldown.shadowmeld.up&!cooldown.vanish.up&cooldown.shadow_dance.charges<=1)
actions.stealth_als+=/call_action_list,name=stealth_cds,if=target.time_to_die<12*cooldown.shadow_dance.charges_fractional*(1+equipped.shadow_satyrs_walk*0.5)

# Stealth Cooldowns
actions.stealth_cds=shadow_dance,if=charges_fractional>=2.45
actions.stealth_cds+=/vanish
actions.stealth_cds+=/sprint_offensive
actions.stealth_cds+=/shadow_dance,if=charges>=2&combo_points<=1
actions.stealth_cds+=/pool_resource,for_next=1,extra_amount=40
actions.stealth_cds+=/shadowmeld,if=energy>=40&energy.deficit>=10+variable.ssw_refund
actions.stealth_cds+=/shadow_dance,if=combo_points<=1

# Stealthed Rotation
actions.stealthed=symbols_of_death,if=(buff.symbols_of_death.remains<target.time_to_die-4&buff.symbols_of_death.remains<=buff.symbols_of_death.duration*0.3)|equipped.shadow_satyrs_walk&energy.time_to_max<0.25
actions.stealthed+=/call_action_list,name=finish,if=combo_points>=5
actions.stealthed+=/shuriken_storm,if=buff.shadowmeld.down&((combo_points.deficit>=3&spell_targets.shuriken_storm>=2+talent.premeditation.enabled+equipped.shadow_satyrs_walk)|buff.the_dreadlords_deceit.stack>=29)
actions.stealthed+=/shadowstrike

head=cowl_of_fright,id=139205,bonus_id=1805/43/1507/3337
neck=sea_fan_pendant,id=142428,bonus_id=3507/1497,enchant=mark_of_the_hidden_satyr
shoulders=steelgazer_hide_mantle,id=134154,bonus_id=3417/43/1542/3337
back=drape_of_the_manastarved,id=141543,bonus_id=1808/1487/3337,gems=200agi,enchant=200agi
chest=biornskin_vest,id=134197,bonus_id=3417/1552/3337
shirt=common_gray_shirt,id=3428
wrists=denial_of_the_halfgiants,id=137100,bonus_id=3459/3458
hands=cruel_vice_grips,id=133617,bonus_id=3510/1537/3337
waist=strand_of_whelk_shells,id=142416,bonus_id=3507/1808/1497,gems=150mastery
legs=legwraps_of_unworthy_souls,id=133616,bonus_id=3418/1532/3337
feet=shadow_satyrs_walk,id=137032,bonus_id=3459/3458
finger1=grubby_silver_ring,id=139236,bonus_id=1806/1808/1502,gems=150vers,enchant=200mastery
finger2=ring_of_collapsing_futures,id=142173,bonus_id=40/3453/1482/3336,enchant=200vers
trinket1=convergence_of_fates,id=140806,bonus_id=3519
trinket2=entwined_elemental_foci,id=140796,bonus_id=3519
main_hand=fangs_of_the_devourer,id=128476,bonus_id=743,gem_id=139267/142512/139253/0,relic_id=1806:1507:3336/3468:1492/1806:1502/0
off_hand=fangs_of_the_devourer,id=128479

# Gear Summary
# gear_ilvl=891.06
# gear_agility=20768
# gear_stamina=28183
# gear_crit_rating=5349
# gear_haste_rating=3511
# gear_mastery_rating=8343
# gear_versatility_rating=3832
# gear_avoidance_rating=419
# gear_armor=2297

CoF+NF : 626448 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
626447.6 626447.6 749.4 / 0.120% 107073.9 / 17.1% 20776.4
RPS Out RPS In Primary Resource Waiting APM Active Skill
30.1 30.1 Energy 20.14% 59.3 100.0% 100%
Origin https://eu.api.battle.net/wow/character/dalaran/Esdeåth/advanced
Talents
  • 15: Master of Subtlety (Subtlety Rogue)
  • 30: Subterfuge
  • 45: Deeper Stratagem
  • 90: Premeditation (Subtlety Rogue)
  • 100: Master of Shadows (Subtlety Rogue)
  • Talent Calculator
Artifact
Professions
  • alchemy: 800
  • enchanting: 133

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
CoF+NF 626448
auto_attack_mh 6944 1.1% 80.2 2.93sec 26195 16772 Direct 80.2 25045 50085 26194 23.7% 19.1%  

Stats details: auto_attack_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 80.21 80.21 0.00 0.00 1.5618 0.0000 2101137.16 3088870.65 31.98 16772.33 16772.33
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 45.92 57.24% 25044.62 19317 25498 25047.17 24146 25498 1149958 1690547 31.98
crit 18.99 23.68% 50085.33 38633 50996 50090.16 47776 50996 951179 1398324 31.98
miss 15.30 19.08% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_mh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
auto_attack_oh 3460 0.6% 79.8 2.95sec 13117 8355 Direct 79.8 12520 25044 13117 23.8% 19.0%  

Stats details: auto_attack_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 79.79 79.79 0.00 0.00 1.5701 0.0000 1046669.25 1538702.95 31.98 8354.77 8354.77
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 45.65 57.21% 12520.14 9658 12749 12521.73 12096 12749 571548 840230 31.98
crit 18.97 23.78% 25044.33 19317 25498 25045.76 23643 25498 475121 698473 31.98
miss 15.17 19.01% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_oh

Static Values
  • id:1
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Backstab 26815 4.3% 47.5 6.04sec 170621 169860 Direct 47.5 137911 275805 170620 23.7% 0.0%  

Stats details: backstab

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.47 47.47 0.00 0.00 1.0045 0.0000 8098565.68 11905658.67 31.98 169859.59 169859.59
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 36.21 76.28% 137911.16 106732 140886 137920.58 133724 140444 4993214 7340498 31.98
crit 11.26 23.72% 275805.00 213463 281772 275822.37 258596 281772 3105352 4565161 31.98
 
 

Action details: backstab

Static Values
  • id:53
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:53
  • name:Backstab
  • school:physical
  • tooltip:
  • description:Stab the target, causing ${$sw2*$<mult>} Physical damage. Damage increased by {$s4=30}% when you are behind your target. |cFFFFFFFFAwards {$s3=1} combo $lpoint:points;.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.70
 
Collapse 1909 0.3% 6.9 29.80sec 82708 0 Direct 6.9 66606 133265 82704 24.2% 0.0%  

Stats details: collapse

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.88 6.88 0.00 0.00 0.0000 0.0000 569042.43 569042.43 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.22 75.84% 66605.57 50574 66758 66186.19 0 66758 347565 347565 0.00
crit 1.66 24.16% 133265.47 101148 133516 102864.31 0 133516 221478 221478 0.00
 
 

Action details: collapse

Static Values
  • id:234142
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:15.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:234142
  • name:Collapse
  • school:shadow
  • tooltip:
  • description:Deal {$s1=40000} Shadow damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:40000.00
  • base_dd_max:40000.00
 
Eviscerate 193388 30.9% 59.0 5.07sec 984667 980256 Direct 59.0 709400 1419743 984626 38.8% 0.0%  

Stats details: eviscerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 59.03 59.03 0.00 0.00 1.0045 0.0000 58123318.64 85446784.00 31.98 980256.33 980256.33
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 36.15 61.25% 709399.72 432169 848849 709636.34 662009 755500 25647167 37703764 31.98
crit 22.87 38.75% 1419743.01 864338 1697697 1420282.88 1253174 1560122 32476152 47743020 31.98
 
 

Action details: eviscerate

Static Values
  • id:196819
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.15
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:196819
  • name:Eviscerate
  • school:physical
  • tooltip:
  • description:Finishing move that disembowels the target, causing damage per combo point. 1 point : ${$m1*1} damage 2 points: ${$m1*2} damage 3 points: ${$m1*3} damage 4 points: ${$m1*4} damage 5 points: ${$m1*5} damage{$?s193531=false}[ 6 points: ${$m1*6} damage][]
Weapon
  • normalized:false
  • weapon_power_mod:0.000000
  • weapon_multiplier:0.00
 
Goremaw's Bite 0 (9985) 0.0% (1.6%) 4.6 64.11sec 649427 646653

Stats details: goremaws_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.63 0.00 0.00 0.00 1.0045 0.0000 0.00 0.00 0.00 646652.78 646652.78
 
 

Action details: goremaws_bite

Static Values
  • id:209782
  • school:shadow
  • resource:none
  • range:8.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!stealthed.all&cooldown.shadow_dance.charges_fractional<=2.45&((combo_points.deficit>=4-(time<10)*2&energy.deficit>50+talent.vigor.enabled*25-(time>=10)*15)|target.time_to_die<8)
Spelldata
  • id:209782
  • name:Goremaw's Bite
  • school:physical
  • tooltip:
  • description:Lashes out at the target, inflicting ${$209783sw2+$209784sw2} Shadow damage and reducing movement speed by {$209786s1=60}% for {$209786d=8 seconds}. Grants $220901o2 Energy over {$220901d=6 seconds}. |cFFFFFFFFAwards {$220901s1=3} combo $lpoint:points;.|r
 
    Goremaw's Bite (_mh) 6662 1.1% 4.6 64.11sec 433434 0 Direct 4.6 349677 699518 433455 23.9% 0.0%  

Stats details: goremaws_bite_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.63 4.63 0.00 0.00 0.0000 0.0000 2008155.05 2008155.05 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 3.52 76.06% 349677.26 272066 359127 348821.45 0 359127 1232231 1232231 0.00
crit 1.11 23.94% 699517.88 544132 718254 492963.62 0 718254 775924 775924 0.00
 
 

Action details: goremaws_bite_mh

Static Values
  • id:209783
  • school:shadow
  • resource:none
  • range:8.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:209783
  • name:Goremaw's Bite
  • school:shadow
  • tooltip:
  • description:{$@spelldesc209782=Lashes out at the target, inflicting ${$209783sw2+$209784sw2} Shadow damage and reducing movement speed by {$209786s1=60}% for {$209786d=8 seconds}. Grants $220901o2 Energy over {$220901d=6 seconds}. |cFFFFFFFFAwards {$220901s1=3} combo $lpoint:points;.|r}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:10.00
 
    Goremaw's Bite (_oh) 3323 0.5% 4.6 64.11sec 215992 0 Direct 4.6 174840 349819 215996 23.5% 0.0%  

Stats details: goremaws_bite_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.63 4.63 0.00 0.00 0.0000 0.0000 1000720.35 1000720.35 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 3.54 76.48% 174840.30 136039 179572 174506.54 0 179572 619548 619548 0.00
crit 1.09 23.52% 349818.67 272079 359144 247934.01 0 359144 381172 381172 0.00
 
 

Action details: goremaws_bite_oh

Static Values
  • id:209784
  • school:shadow
  • resource:none
  • range:8.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:209784
  • name:Goremaw's Bite
  • school:shadow
  • tooltip:
  • description:{$@spelldesc209782=Lashes out at the target, inflicting ${$209783sw2+$209784sw2} Shadow damage and reducing movement speed by {$209786s1=60}% for {$209786d=8 seconds}. Grants $220901o2 Energy over {$220901d=6 seconds}. |cFFFFFFFFAwards {$220901s1=3} combo $lpoint:points;.|r}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:10.00
 
Mark of the Hidden Satyr 8784 1.4% 16.3 18.23sec 161751 0 Direct 16.3 130803 261575 161757 23.7% 0.0%  

Stats details: mark_of_the_hidden_satyr

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.34 16.34 0.00 0.00 0.0000 0.0000 2643708.47 2643708.47 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 12.48 76.33% 130803.28 100276 132364 130807.42 124342 132364 1631950 1631950 0.00
crit 3.87 23.67% 261574.83 200552 264729 256591.40 0 264729 1011759 1011759 0.00
 
 

Action details: mark_of_the_hidden_satyr

Static Values
  • id:191259
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191259
  • name:Mark of the Hidden Satyr
  • school:fire
  • tooltip:
  • description:Deals fire damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:2.500000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Nightblade 120625 19.3% 17.0 17.55sec 2134178 2124697 Periodic 145.6 201955 403831 249632 23.6% 0.0% 96.7%

Stats details: nightblade

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.03 0.00 145.60 145.60 1.0045 2.0000 36345062.35 36345062.35 0.00 117889.77 2124696.74
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 111.2 76.38% 201955.16 137013 224267 201971.32 196284 207294 22459595 22459595 0.00
crit 34.4 23.62% 403831.35 274025 448534 403859.45 379959 431776 13885467 13885467 0.00
 
 

Action details: nightblade

Static Values
  • id:195452
  • school:shadow
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:25.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:target.time_to_die>8&((refreshable&(!finality|buff.finality_nightblade.up))|remains<tick_time)
Spelldata
  • id:195452
  • name:Nightblade
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec and snared by attacks.
  • description:Finishing move that infects the target with shadowy energy, dealing Shadow damage over time and causing attacks against the target to reduce movement speed by {$206760s1=30}% for {$206760d=8 seconds}. Lasts longer per combo point. 1 point : ${$m1*8/2} over 8 sec 2 points: ${$m1*10/2} over 10 sec 3 points: ${$m1*12/2} over 12 sec 4 points: ${$m1*14/2} over 14 sec 5 points: ${$m1*16/2} over 16 sec{$?s193531=false}[ 6 points: ${$m1*18/2} over 18 sec][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:1.380000
  • spell_power_mod.tick:0.000000
  • base_td:1.00
  • dot_duration:6.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Potion of the Old War 18567 2.9% 23.2 5.18sec 236976 0 Direct 23.2 191834 383736 236965 23.5% 0.0%  

Stats details: potion_of_the_old_war

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.15 23.15 0.00 0.00 0.0000 0.0000 5486135.49 8065138.83 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.70 76.48% 191833.59 146122 192882 191825.63 184845 192882 3396358 4992968 31.98
crit 5.45 23.52% 383735.94 292245 385763 382847.01 0 385763 2089777 3072171 31.90
 
 

Action details: potion_of_the_old_war

Static Values
  • id:188028
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188028
  • name:Potion of the Old War
  • school:physical
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:135920.00
  • base_dd_max:203880.00
 
Recursive Strikes 42193 6.7% 84.2 4.89sec 150427 0 Direct 84.2 121830 243366 150426 23.5% 0.0%  

Stats details: recursive_strikes

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 84.23 84.23 0.00 0.00 0.0000 0.0000 12670238.24 18626450.38 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 64.41 76.47% 121830.01 24772 174395 120793.23 74935 154482 7847124 11536016 31.98
crit 19.82 23.53% 243366.19 49544 348790 241142.50 108997 329765 4823114 7090434 31.98
 
 

Action details: recursive_strikes

Static Values
  • id:225739
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:225739
  • name:Recursive Strikes
  • school:physical
  • tooltip:
  • description:{$@spelldesc225135=Your attacks have a chance to grant Recursive Strikes for {$225736d=15 seconds}, causing your auto attacks to deal an additional {$225736s1=3602} damage and increase the intensity of Recursive Strikes.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:9601.48
  • base_dd_max:9601.48
 
Shadow Blades 0 (24061) 0.0% (3.8%) 3.6 98.32sec 2031275 0

Stats details: shadow_blades

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.55 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: shadow_blades

Static Values
  • id:121471
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:combo_points<=2|(equipped.denial_of_the_halfgiants&combo_points>=1)
Spelldata
  • id:121471
  • name:Shadow Blades
  • school:physical
  • tooltip:Autoattacks deal pure Shadow damage. Combo-point-generating attacks generate {$s2=1} additional combo point.
  • description:Draws upon surrounding shadows to empower your weapons, causing auto attacks to deal Shadow damage and abilities that generate combo points to generate 1 additional combo point. Lasts {$d=15 seconds}.
 
    Shadow Blade (_mh) 16041 2.6% 104.8 2.73sec 45920 30655 Direct 104.8 37147 74289 45920 23.6% 0.0%  

Stats details: shadow_blade_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 104.81 104.81 0.00 0.00 1.4980 0.0000 4812988.03 4812988.03 0.00 30655.39 30655.39
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 80.05 76.38% 37146.61 28397 37484 37147.16 36511 37484 2973739 2973739 0.00
crit 24.76 23.62% 74289.27 56794 74969 74288.98 71740 74969 1839249 1839249 0.00
 
 

Action details: shadow_blade_mh

Static Values
  • id:121473
  • school:shadow
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:121473
  • name:Shadow Blade
  • school:shadow
  • tooltip:
  • description:Strike with dark energy, dealing Shadow damage equal to {$s1=1}% weapon damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
    Shadow Blade Off-hand 8020 1.3% 104.8 2.73sec 22959 15327 Direct 104.8 18573 37145 22959 23.6% 0.0%  

Stats details: shadow_blade_offhand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 104.81 104.81 0.00 0.00 1.4980 0.0000 2406387.51 2406387.51 0.00 15327.02 15327.02
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 80.06 76.38% 18573.22 14199 18742 18573.43 18168 18742 1486975 1486975 0.00
crit 24.75 23.62% 37145.12 28397 37484 37146.13 35354 37484 919413 919413 0.00
 
 

Action details: shadow_blade_offhand

Static Values
  • id:121474
  • school:shadow
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:121474
  • name:Shadow Blade Off-hand
  • school:shadow
  • tooltip:
  • description:Strike with dark energy, dealing Shadow damage equal to {$s1=1}% weapon damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Shadow Nova 11435 1.8% 33.6 9.15sec 102214 0 Direct 33.6 82592 165185 102217 23.8% 0.0%  

Stats details: shadow_nova

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 33.63 33.63 0.00 0.00 0.0000 0.0000 3437804.52 3437804.52 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 25.64 76.24% 82591.86 68830 82595 82591.83 81871 82595 2117881 2117881 0.00
crit 7.99 23.76% 165184.61 137659 165191 165183.79 159684 165191 1319924 1319924 0.00
 
 

Action details: shadow_nova

Static Values
  • id:197800
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:5.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:197800
  • name:Shadow Nova
  • school:shadow
  • tooltip:
  • description:Deals {$s1=0} Shadow damage to enemies with $A1 yards.
 
Shadowstrike 128433 (158282) 20.5% (25.3%) 111.3 2.72sec 427265 425352 Direct 111.3 260259 520529 346676 33.2% 0.0%  

Stats details: shadowstrike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 111.32 111.32 0.00 0.00 1.0045 0.0000 38591321.43 56732897.97 31.98 425351.55 425351.55
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 74.36 66.80% 260259.32 216893 260271 260259.69 258464 260271 19352277 28449680 31.98
crit 36.96 33.20% 520528.60 433785 520542 520528.40 516093 520542 19239045 28283218 31.98
 
 

Action details: shadowstrike

Static Values
  • id:185438
  • school:physical
  • resource:energy
  • range:15.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:185438
  • name:Shadowstrike
  • school:physical
  • tooltip:
  • description:Strike through the shadows, $?a231718[appearing behind your target and ][]dealing $sw2 Physical damage. |cFFFFFFFFAwards {$s3=1} combo $lpoint:points;.|r
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:8.50
 
    Soul Rip 29849 4.8% 110.7 2.70sec 81067 0 Direct 110.7 65553 131106 81068 23.7% 0.0%  

Stats details: soul_rip

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 110.66 110.66 0.00 0.00 0.0000 0.0000 8971063.00 8971063.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 84.47 76.33% 65553.23 65553 65553 65553.23 65553 65553 5537485 5537485 0.00
crit 26.19 23.67% 131106.47 131106 131106 131106.47 131106 131106 3433578 3433578 0.00
 
 

Action details: soul_rip

Static Values
  • id:220893
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:220893
  • name:Soul Rip
  • school:shadow
  • tooltip:
  • description:{$@spelldesc209835=After using Shadowstrike or Cheap Shot, Akaari's Soul appears $m1 sec later and Soul Rips your target, dealing {$220893s1=1} Shadow damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:1.500000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Simple Action Stats Execute Interval
CoF+NF
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:CoF+NF
  • harmful:false
  • if_expr:
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:CoF+NF
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:CoF+NF
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Shadow Dance 28.2 10.73sec

Stats details: shadow_dance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 28.17 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: shadow_dance

Static Values
  • id:185313
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:charges_fractional>=2.45
Spelldata
  • id:185313
  • name:Shadow Dance
  • school:physical
  • tooltip:
  • description:Allows use of all Stealth abilities and grants all the combat benefits of Stealth for {$d=3 seconds}. Effect not broken from taking damage or attacking. {$?s14062=false}[Movement speed while active is increased by {$1784s3=0}% and damage dealt is increased by {$1784s4=0}%. ]?s108209[Abilities cost {$112942s1=75}% less while active. ][]{$?s31223=false}[Attacks from Shadow Dance and for {$31223s1=5} sec after deal {$31665s1=10}% more damage. ][]
 
Sprint 2.7 122.45sec

Stats details: sprint

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.74 0.00 86.75 0.00 0.0000 0.2500 0.00 0.00 0.00 0.00 0.00
 
 

Action details: sprint

Static Values
  • id:2983
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:2983
  • name:Sprint
  • school:physical
  • tooltip:Movement speed increased by $w1%.
  • description:Increases your movement speed by {$s1=70}% for {$d=8 seconds}. Usable while stealthed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:0.25
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Symbols of Death 14.1 22.43sec

Stats details: symbols_of_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.09 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: symbols_of_death

Static Values
  • id:212283
  • school:physical
  • resource:energy
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:10.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:212283
  • name:Symbols of Death
  • school:physical
  • tooltip:All damage done increased by {$s1=20}%.
  • description:Invoke ancient symbols of power, increasing all damage you deal by {$s1=20}% for {$d=35 seconds}, and causing your next Shadowstrike to critically strike. Unaffected by the global cooldown.
 
Vanish 2.8 122.53sec

Stats details: vanish

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.84 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: vanish

Static Values
  • id:1856
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:1856
  • name:Vanish
  • school:physical
  • tooltip:Improved stealth.
  • description:Allows you to vanish from sight, entering stealth while in combat. For the first {$11327d=3 seconds} after vanishing, damage and harmful effects received will not break stealth. Also breaks movement impairing effects.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 37.57% 0.0(0.0) 1.0

Buff details

  • buff initial source:CoF+NF
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Death 14.1 0.0 21.5sec 22.4sec 1.35% 12.53% 0.0(0.0) 0.2

Buff details

  • buff initial source:CoF+NF
  • cooldown name:buff_death
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • death_1:1.35%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:227151
  • name:Death
  • tooltip:Your next Shadowstrike will critically strike.
  • description:{$@spelldesc212283=Invoke ancient symbols of power, increasing all damage you deal by {$s1=20}% for {$d=35 seconds}, and causing your next Shadowstrike to critically strike. Unaffected by the global cooldown.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Faster Than Light Trigger 2.7 0.0 122.4sec 122.4sec 2.72% 2.72% 0.0(0.0) 2.7

Buff details

  • buff initial source:CoF+NF
  • cooldown name:buff_faster_than_light_trigger
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • faster_than_light_trigger_1:2.72%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:197270
  • name:Faster Than Light Trigger
  • tooltip:
  • description:
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
Finality: Eviscerate 29.8 0.0 10.1sec 10.1sec 49.03% 49.58% 0.0(0.0) 0.0

Buff details

  • buff initial source:CoF+NF
  • cooldown name:buff_finality_eviscerate
  • max_stacks:10
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.04

Stack Uptimes

  • finality_eviscerate_5:18.34%
  • finality_eviscerate_6:30.69%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:197496
  • name:Finality: Eviscerate
  • tooltip:Your next Eviscerate will do $w1% increased damage.
  • description:
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Finality: Nightblade 8.7 0.0 35.3sec 35.3sec 42.76% 40.47% 0.0(0.0) 0.0

Buff details

  • buff initial source:CoF+NF
  • cooldown name:buff_finality_nightblade
  • max_stacks:6
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.04

Stack Uptimes

  • finality_nightblade_5:13.79%
  • finality_nightblade_6:28.97%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:197498
  • name:Finality: Nightblade
  • tooltip:Your next Nightblade will do $w1% increased damage.
  • description:
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Goremaw's Bite 4.6 0.0 64.1sec 64.1sec 9.12% 9.12% 27.5(27.5) 4.5

Buff details

  • buff initial source:CoF+NF
  • cooldown name:buff_goremaws_bite
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • goremaws_bite_1:9.12%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:220901
  • name:Goremaw's Bite
  • tooltip:Generating {$s2=5} Energy every $t2 sec.
  • description:{$@spelldesc209782=Lashes out at the target, inflicting ${$209783sw2+$209784sw2} Shadow damage and reducing movement speed by {$209786s1=60}% for {$209786d=8 seconds}. Grants $220901o2 Energy over {$220901d=6 seconds}. |cFFFFFFFFAwards {$220901s1=3} combo $lpoint:points;.|r}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Master of Subtlety 38.6 1.6 7.9sec 7.5sec 34.85% 48.98% 1.6(1.6) 11.9

Buff details

  • buff initial source:CoF+NF
  • cooldown name:buff_master_of_subtlety
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • master_of_subtlety_1:34.85%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:31223
  • name:Master of Subtlety
  • tooltip:
  • description:Attacks made while stealthed and for {$s1=5} seconds after breaking stealth cause an additional {$31665s1=10}% damage.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Master of Subtlety (_aura) 38.6 1.6 7.9sec 7.6sec 51.30% 34.95% 1.6(1.6) 0.0

Buff details

  • buff initial source:CoF+NF
  • cooldown name:buff_master_of_subtlety_aura
  • max_stacks:1
  • duration:150.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • master_of_subtlety_aura_1:51.30%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:31223
  • name:Master of Subtlety
  • tooltip:
  • description:Attacks made while stealthed and for {$s1=5} seconds after breaking stealth cause an additional {$31665s1=10}% damage.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of the Old War 2.0 0.0 87.2sec 0.0sec 16.24% 16.24% 0.0(0.0) 2.0

Buff details

  • buff initial source:CoF+NF
  • cooldown name:buff_potion_of_the_old_war
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_the_old_war_1:16.24%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188028
  • name:Potion of the Old War
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Recursive Strikes 4.5 85.4 61.5sec 2.6sec 24.54% 100.00% 24.9(24.9) 4.2

Buff details

  • buff initial source:CoF+NF
  • cooldown name:buff_recursive_strikes
  • max_stacks:15
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • recursive_strikes_1:0.80%
  • recursive_strikes_2:1.08%
  • recursive_strikes_3:1.50%
  • recursive_strikes_4:1.11%
  • recursive_strikes_5:1.45%
  • recursive_strikes_6:1.13%
  • recursive_strikes_7:1.43%
  • recursive_strikes_8:1.14%
  • recursive_strikes_9:1.40%
  • recursive_strikes_10:1.15%
  • recursive_strikes_11:1.37%
  • recursive_strikes_12:1.14%
  • recursive_strikes_13:1.36%
  • recursive_strikes_14:1.06%
  • recursive_strikes_15:7.43%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225736
  • name:Recursive Strikes
  • tooltip:Your auto attacks deal an additional $w1 damage and increase the potency of this effect.
  • description:{$@spelldesc225135=Your attacks have a chance to grant Recursive Strikes for {$225736d=15 seconds}, causing your auto attacks to deal an additional {$225736s1=3602} damage and increase the intensity of Recursive Strikes.}
  • max_stacks:15
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Shadow Blades 3.6 0.0 97.5sec 98.4sec 55.91% 60.43% 0.0(0.0) 3.1

Buff details

  • buff initial source:CoF+NF
  • cooldown name:buff_shadow_blades
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • shadow_blades_1:55.91%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:121471
  • name:Shadow Blades
  • tooltip:Autoattacks deal pure Shadow damage. Combo-point-generating attacks generate {$s2=1} additional combo point.
  • description:Draws upon surrounding shadows to empower your weapons, causing auto attacks to deal Shadow damage and abilities that generate combo points to generate 1 additional combo point. Lasts {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Shadow Dance 28.2 0.0 10.7sec 10.7sec 46.51% 46.51% 0.0(0.0) 27.8

Buff details

  • buff initial source:CoF+NF
  • cooldown name:buff_shadow_dance
  • max_stacks:1
  • duration:5.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • shadow_dance_1:46.51%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:185313
  • name:Shadow Dance
  • tooltip:
  • description:Allows use of all Stealth abilities and grants all the combat benefits of Stealth for {$d=3 seconds}. Effect not broken from taking damage or attacking. {$?s14062=false}[Movement speed while active is increased by {$1784s3=0}% and damage dealt is increased by {$1784s4=0}%. ]?s108209[Abilities cost {$112942s1=75}% less while active. ][]{$?s31223=false}[Attacks from Shadow Dance and for {$31223s1=5} sec after deal {$31665s1=10}% more damage. ][]
  • max_stacks:0
  • duration:3.00
  • cooldown:1.00
  • default_chance:0.00%
Sprint 2.7 0.0 122.4sec 122.4sec 7.20% 7.20% 86.7(86.7) 2.7

Buff details

  • buff initial source:CoF+NF
  • cooldown name:buff_sprint
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • sprint_1:7.20%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2983
  • name:Sprint
  • tooltip:Movement speed increased by $w1%.
  • description:Increases your movement speed by {$s1=70}% for {$d=8 seconds}. Usable while stealthed.
  • max_stacks:0
  • duration:8.00
  • cooldown:120.00
  • default_chance:0.00%
Stealth 6.5 0.0 45.0sec 52.2sec 1.02% 1.02% 0.0(0.0) 0.0

Buff details

  • buff initial source:CoF+NF
  • cooldown name:buff_stealth
  • max_stacks:1
  • duration:150.00
  • cooldown:2.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stealth_1:1.02%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:1784
  • name:Stealth
  • tooltip:Stealthed.$?$w3!=0[ Movement speed increased by $w3%.][]$?$w4!=0[ Damage increased by $w4%.][]
  • description:Conceals you in the shadows until cancelled, allowing you to stalk enemies without being seen. {$?s14062=false}[Movement speed while stealthed is increased by {$s3=0}% and damage dealt is increased by {$s4=0}%.]?s108209[ Abilities cost {$112942s1=75}% less while stealthed. ][]{$?s31223=false}[ Attacks from Stealth and for {$31223s1=5} sec after deal {$31665s1=10}% more damage.][]
  • max_stacks:0
  • duration:-0.00
  • cooldown:2.00
  • default_chance:100.00%
Subterfuge 6.6 0.0 44.6sec 52.3sec 6.54% 6.54% 0.0(0.0) 6.5

Buff details

  • buff initial source:CoF+NF
  • cooldown name:buff_subterfuge
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • subterfuge_1:6.54%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:115192
  • name:Subterfuge
  • tooltip:Temporarily concealed in the shadows.
  • description:{$@spelldesc108208=Your abilities requiring Stealth can still be used for {$115192d=3 seconds} after Stealth breaks.$?c3[ Also increases the duration of Shadow Dance by ${$m2/1000} sec.][ Also causes Garrote to deal {$115192s2=125}% increased damage and have no cooldown when used from Stealth or {$115192d=3 seconds} after Stealth breaks.]}
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
Symbols of Death 1.1 13.0 193.6sec 22.4sec 99.87% 99.38% 13.0(13.0) 0.2

Buff details

  • buff initial source:CoF+NF
  • cooldown name:buff_symbols_of_death
  • max_stacks:1
  • duration:35.00
  • cooldown:10.00
  • default_chance:100.00%
  • default_value:1.20

Stack Uptimes

  • symbols_of_death_1:99.87%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:212283
  • name:Symbols of Death
  • tooltip:All damage done increased by {$s1=20}%.
  • description:Invoke ancient symbols of power, increasing all damage you deal by {$s1=20}% for {$d=35 seconds}, and causing your next Shadowstrike to critically strike. Unaffected by the global cooldown.
  • max_stacks:0
  • duration:35.00
  • cooldown:10.00
  • default_chance:0.00%
Temptation 2.1 4.8 114.9sec 29.5sec 44.55% 68.00% 0.0(0.0) 1.8

Buff details

  • buff initial source:CoF+NF
  • cooldown name:buff_temptation
  • max_stacks:10
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • temptation_1:11.15%
  • temptation_2:11.81%
  • temptation_3:12.29%
  • temptation_4:8.98%
  • temptation_5:0.25%
  • temptation_6:0.05%
  • temptation_7:0.03%
  • temptation_8:0.04%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:234143
  • name:Temptation
  • tooltip:Increased chance for your Ring of Collapsing Futures to incur a {$s1=5} min cooldown.
  • description:{$@spelldesc234142=Deal {$s1=40000} Shadow damage to an enemy.}
  • max_stacks:10
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Vanish 5.6 0.0 52.1sec 52.1sec 5.53% 5.53% 0.0(0.0) 5.5

Buff details

  • buff initial source:CoF+NF
  • cooldown name:buff_vanish
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • vanish_1:5.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:11327
  • name:Vanish
  • tooltip:Improved stealth.$?$w3!=0[ Movement speed increased by $w3%.][]$?$w4!=0[ Damage increased by $w4%.][]
  • description:
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:CoF+NF
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Seventh Demon

Buff details

  • buff initial source:CoF+NF
  • cooldown name:buff_flask_of_the_seventh_demon
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:1300.00

Stack Uptimes

  • flask_of_the_seventh_demon_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188033
  • name:Flask of the Seventh Demon
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (seedbattered_fish_plate)

Buff details

  • buff initial source:CoF+NF
  • cooldown name:buff_seedbattered_fish_plate
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:versatility_rating
  • amount:375.00

Stack Uptimes

  • seedbattered_fish_plate_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225605
  • name:Well Fed
  • tooltip:Versatility increased by $w1.
  • description:Increases versatility by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
CoF+NF
backstab Energy 47.5 1661.3 35.0 35.0 4874.9
eviscerate Energy 59.0 2065.9 35.0 35.0 28134.0
eviscerate Combo Points 59.0 333.8 5.7 5.7 174113.8
nightblade Energy 17.0 425.7 25.0 25.0 85369.2
nightblade Combo Points 17.0 96.4 5.7 5.7 377024.4
shadowstrike Energy 111.3 4452.7 40.0 40.0 10681.7
symbols_of_death Energy 14.1 458.0 32.5 32.5 0.0
Resource Gains Type Count Total Average Overflow
backstab Combo Points 47.47 47.47 (10.96%) 1.00 0.00 0.00%
goremaws_bite Combo Points 4.63 13.70 (3.16%) 2.96 0.20 1.41%
shadowstrike Combo Points 111.32 222.63 (51.40%) 2.00 0.00 0.00%
energy_regen Energy 1108.70 3322.81 (36.90%) 3.00 107.98 3.15%
Shadow Techniques Combo Points 75.00 70.20 (16.21%) 0.94 19.74 21.95%
Master of Shadows Energy 39.27 805.33 (8.94%) 20.51 176.36 17.96%
Shadow Blades Combo Points 93.28 79.11 (18.26%) 0.85 14.17 15.19%
Energetic Stabbing Energy 27.76 694.00 (7.71%) 25.00 0.00 0.00%
Goremaw's Bite Energy 27.45 133.00 (1.48%) 4.85 4.25 3.10%
Relentless Strikes Energy 76.06 3382.77 (37.56%) 44.48 58.10 1.69%
Shadow Satyr's Walk Energy 111.32 667.90 (7.42%) 6.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Energy 29.89 30.08
Combo Points 1.44 1.43
Combat End Resource Mean Min Max
Energy 42.68 6.20 100.00
Combo Points 2.85 0.00 6.00

Benefits & Uptimes

Benefits %
Uptimes %
Energy Cap 1.7%

Statistics & Data Analysis

Fight Length
Sample Data CoF+NF Fight Length
Count 4999
Mean 301.28
Minimum 222.03
Maximum 381.32
Spread ( max - min ) 159.29
Range [ ( max - min ) / 2 * 100% ] 26.44%
DPS
Sample Data CoF+NF Damage Per Second
Count 4999
Mean 626447.62
Minimum 538255.53
Maximum 775894.67
Spread ( max - min ) 237639.14
Range [ ( max - min ) / 2 * 100% ] 18.97%
Standard Deviation 27035.1113
5th Percentile 584915.24
95th Percentile 673150.03
( 95th Percentile - 5th Percentile ) 88234.80
Mean Distribution
Standard Deviation 382.3725
95.00% Confidence Intervall ( 625698.18 - 627197.05 )
Normalized 95.00% Confidence Intervall ( 99.88% - 100.12% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 72
0.1% Error 7155
0.1 Scale Factor Error with Delta=300 6239360
0.05 Scale Factor Error with Delta=300 24957438
0.01 Scale Factor Error with Delta=300 623935927
Priority Target DPS
Sample Data CoF+NF Priority Target Damage Per Second
Count 4999
Mean 626447.62
Minimum 538255.53
Maximum 775894.67
Spread ( max - min ) 237639.14
Range [ ( max - min ) / 2 * 100% ] 18.97%
Standard Deviation 27035.1113
5th Percentile 584915.24
95th Percentile 673150.03
( 95th Percentile - 5th Percentile ) 88234.80
Mean Distribution
Standard Deviation 382.3725
95.00% Confidence Intervall ( 625698.18 - 627197.05 )
Normalized 95.00% Confidence Intervall ( 99.88% - 100.12% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 72
0.1% Error 7155
0.1 Scale Factor Error with Delta=300 6239360
0.05 Scale Factor Error with Delta=300 24957438
0.01 Scale Factor Error with Delta=300 623935927
DPS(e)
Sample Data CoF+NF Damage Per Second (Effective)
Count 4999
Mean 626447.62
Minimum 538255.53
Maximum 775894.67
Spread ( max - min ) 237639.14
Range [ ( max - min ) / 2 * 100% ] 18.97%
Damage
Sample Data CoF+NF Damage
Count 4999
Mean 188312317.61
Minimum 134986778.67
Maximum 249456677.61
Spread ( max - min ) 114469898.94
Range [ ( max - min ) / 2 * 100% ] 30.39%
DTPS
Sample Data CoF+NF Damage Taken Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data CoF+NF Healing Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data CoF+NF Healing Per Second (Effective)
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data CoF+NF Heal
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data CoF+NF Healing Taken Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data CoF+NF Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data CoF+NFTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data CoF+NF Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,name=flask_of_the_seventh_demon
1 0.00 augmentation,name=defiled
2 0.00 food,name=seedbattered_fish_plate
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 stealth
5 0.00 potion,name=old_war
6 0.00 marked_for_death,if=raid_event.adds.in>40
7 0.00 variable,name=ssw_refund,value=equipped.shadow_satyrs_walk*(4+ssw_refund_offset)
Defined variables that doesn't change during the fight
8 0.00 variable,name=stealth_threshold,value=(15+talent.vigor.enabled*35+talent.master_of_shadows.enabled*30+variable.ssw_refund)
9 0.00 enveloping_shadows,if=combo_points>=5
A 0.00 symbols_of_death
Default action list Executed every time the actor is available.
# count action,conditions
B 0.00 call_action_list,name=cds
C 0.00 run_action_list,name=stealthed,if=stealthed.all
Fully switch to the Stealthed Rotation (by doing so, it forces pooling if nothing is available)
D 0.00 call_action_list,name=finish,if=combo_points>=5|(combo_points>=4&spell_targets.shuriken_storm>=3&spell_targets.shuriken_storm<=4)
E 0.00 call_action_list,name=stealth_als,if=combo_points.deficit>=2+talent.premeditation.enabled
F 0.00 call_action_list,name=build,if=energy.deficit<=variable.stealth_threshold
actions.build Builders
# count action,conditions
0.00 shuriken_storm,if=spell_targets.shuriken_storm>=2
0.00 gloomblade
G 47.47 backstab
actions.cds Cooldowns
# count action,conditions
H 1.00 potion,name=old_war,if=buff.bloodlust.react|target.time_to_die<=25|buff.shadow_blades.up
I 6.88 use_item,slot=finger2,if=(buff.shadow_blades.up&stealthed.rogue)|target.time_to_die<20
0.00 blood_fury,if=stealthed.rogue
0.00 berserking,if=stealthed.rogue
0.00 arcane_torrent,if=stealthed.rogue&energy.deficit>70
J 3.55 shadow_blades,if=combo_points<=2|(equipped.denial_of_the_halfgiants&combo_points>=1)
K 4.64 goremaws_bite,if=!stealthed.all&cooldown.shadow_dance.charges_fractional<=2.45&((combo_points.deficit>=4-(time<10)*2&energy.deficit>50+talent.vigor.enabled*25-(time>=10)*15)|target.time_to_die<8)
0.00 marked_for_death,target_if=min:target.time_to_die,if=target.time_to_die<combo_points.deficit|(raid_event.adds.in>40&combo_points.deficit>=4+talent.deeper_strategem.enabled+talent.anticipation.enabled)
actions.finish Finishers
# count action,conditions
0.00 enveloping_shadows,if=buff.enveloping_shadows.remains<target.time_to_die&buff.enveloping_shadows.remains<=combo_points*1.8
0.00 death_from_above,if=spell_targets.death_from_above>=6
L 17.03 nightblade,cycle_targets=1,if=target.time_to_die>8&((refreshable&(!finality|buff.finality_nightblade.up))|remains<tick_time)
0.00 death_from_above
M 59.03 eviscerate
actions.stealth_cds Stealth Cooldowns
# count action,conditions
R 3.68 shadow_dance,if=charges_fractional>=2.45
S 2.84 vanish
T 2.74 sprint_offensive
U 4.61 shadow_dance,if=charges>=2&combo_points<=1
0.00 pool_resource,for_next=1,extra_amount=40
0.00 shadowmeld,if=energy>=40&energy.deficit>=10+variable.ssw_refund
V 19.88 shadow_dance,if=combo_points<=1
actions.stealthed Stealthed Rotation
# count action,conditions
W 13.09 symbols_of_death,if=(buff.symbols_of_death.remains<target.time_to_die-4&buff.symbols_of_death.remains<=buff.symbols_of_death.duration*0.3)|equipped.shadow_satyrs_walk&energy.time_to_max<0.25
X 0.00 call_action_list,name=finish,if=combo_points>=5
0.00 shuriken_storm,if=buff.shadowmeld.down&((combo_points.deficit>=3&spell_targets.shuriken_storm>=2+talent.premeditation.enabled+equipped.shadow_satyrs_walk)|buff.the_dreadlords_deceit.stack>=29)
Y 111.32 shadowstrike

Sample Sequence

0124578AJIYYLRYYMYYMGSWYMYRYMIYYLGTGMRWYYMYYMGGGMRIYYMYYLUWYYMYMUYYMYYMGGMKGLUWYYMYYMUYYMYYMVYYLYYMVYYJHMYYLVWYYMYGMVYYMYMGGLGGMVYYMWYYLKGMVYYMYYGMVYYYMYSYMYGTGLYWYGMVYYMYYGLVYYMYYMGVYYMWYYMGGGLKGJGMVWYYMYYLVYYMYYMGGMVYYMYGMGGLVYYMYYMVWYYMYGLGGMVYYYMYGMKGGLVWYYMYSYMYTGGLYYGMVWYYYMGGJGLVYYMYYMVYYMWY

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask CoF+NF 100.0/100: 100% energy | 0.0/6: 0% combo_points
Pre precombat 1 augmentation CoF+NF 100.0/100: 100% energy | 0.0/6: 0% combo_points
Pre precombat 2 food CoF+NF 100.0/100: 100% energy | 0.0/6: 0% combo_points
Pre precombat 4 stealth Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, stealth
Pre precombat 5 potion Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, stealth, potion_of_the_old_war
Pre precombat 7 ssw_refund Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, stealth, potion_of_the_old_war
Pre precombat 8 stealth_threshold Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, stealth, potion_of_the_old_war
Pre precombat A symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, stealth, symbols_of_death, death, potion_of_the_old_war
0:00.000 cds J shadow_blades Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, stealth, symbols_of_death, death, potion_of_the_old_war
0:00.000 cds I use_item_ring_of_collapsing_futures Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, stealth, symbols_of_death, shadow_blades, death, potion_of_the_old_war
0:00.000 stealthed Y shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points temptation, master_of_subtlety_aura, stealth, symbols_of_death, shadow_blades, death, potion_of_the_old_war
0:01.002 stealthed Y shadowstrike Fluffy_Pillow 80.3/100: 80% energy | 3.0/6: 50% combo_points bloodlust, temptation, master_of_subtlety_aura, stealth, subterfuge, symbols_of_death, shadow_blades, potion_of_the_old_war
0:02.007 finish L nightblade Fluffy_Pillow 85.6/100: 86% energy | 6.0/6: 100% combo_points bloodlust, temptation, master_of_subtlety_aura, stealth, subterfuge, symbols_of_death, shadow_blades, potion_of_the_old_war
0:03.011 stealth_cds R shadow_dance Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points bloodlust, temptation, master_of_subtlety, symbols_of_death, shadow_blades, finality_nightblade(6), potion_of_the_old_war
0:03.011 stealthed Y shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points bloodlust, temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6), potion_of_the_old_war
0:04.016 stealthed Y shadowstrike Fluffy_Pillow 80.3/100: 80% energy | 4.0/6: 67% combo_points bloodlust, temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6), potion_of_the_old_war
0:05.019 finish M eviscerate Fluffy_Pillow 60.6/100: 61% energy | 6.0/6: 100% combo_points bloodlust, temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6), potion_of_the_old_war
0:06.024 stealthed Y shadowstrike Fluffy_Pillow 79.9/100: 80% energy | 0.0/6: 0% combo_points bloodlust, temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6), potion_of_the_old_war
0:07.029 stealthed Y shadowstrike Fluffy_Pillow 85.2/100: 85% energy | 4.0/6: 67% combo_points bloodlust, temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6), potion_of_the_old_war
0:08.033 finish M eviscerate Fluffy_Pillow 65.5/100: 66% energy | 6.0/6: 100% combo_points bloodlust, temptation, master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6), potion_of_the_old_war
0:09.039 build G backstab Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points bloodlust, temptation, master_of_subtlety, symbols_of_death, shadow_blades, finality_nightblade(6), potion_of_the_old_war
0:10.043 stealth_cds S vanish Fluffy_Pillow 79.3/100: 79% energy | 3.0/6: 50% combo_points bloodlust, temptation, master_of_subtlety, symbols_of_death, shadow_blades, finality_nightblade(6), potion_of_the_old_war
0:10.043 stealthed W symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 3.0/6: 50% combo_points bloodlust, temptation, master_of_subtlety_aura, vanish, symbols_of_death, shadow_blades, finality_nightblade(6), potion_of_the_old_war
0:10.043 stealthed Y shadowstrike Fluffy_Pillow 65.0/100: 65% energy | 3.0/6: 50% combo_points bloodlust, temptation, master_of_subtlety_aura, vanish, symbols_of_death, shadow_blades, death, finality_nightblade(6), potion_of_the_old_war
0:11.047 finish M eviscerate Fluffy_Pillow 70.3/100: 70% energy | 6.0/6: 100% combo_points bloodlust, temptation, master_of_subtlety_aura, vanish, subterfuge, symbols_of_death, shadow_blades, finality_nightblade(6), potion_of_the_old_war
0:12.051 stealthed Y shadowstrike Fluffy_Pillow 89.6/100: 90% energy | 0.0/6: 0% combo_points bloodlust, temptation, master_of_subtlety_aura, vanish, subterfuge, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6), potion_of_the_old_war
0:13.056 stealth_cds R shadow_dance Fluffy_Pillow 94.9/100: 95% energy | 3.0/6: 50% combo_points bloodlust, temptation, master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6), potion_of_the_old_war
0:13.056 stealthed Y shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 3.0/6: 50% combo_points bloodlust, temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6), potion_of_the_old_war
0:14.062 finish M eviscerate Fluffy_Pillow 80.3/100: 80% energy | 6.0/6: 100% combo_points bloodlust, temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6), potion_of_the_old_war
0:15.069 cds I use_item_ring_of_collapsing_futures Fluffy_Pillow 99.7/100: 100% energy | 0.0/6: 0% combo_points bloodlust, temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6), potion_of_the_old_war
0:15.069 stealthed Y shadowstrike Fluffy_Pillow 99.7/100: 100% energy | 0.0/6: 0% combo_points bloodlust, temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6), potion_of_the_old_war
0:16.072 stealthed Y shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 3.0/6: 50% combo_points bloodlust, temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6), potion_of_the_old_war
0:17.076 finish L nightblade Fluffy_Pillow 100.0/100: 100% energy | 6.0/6: 100% combo_points bloodlust, temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6), potion_of_the_old_war
0:18.082 build G backstab Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points bloodlust, temptation(2), master_of_subtlety, symbols_of_death, shadow_blades, potion_of_the_old_war
0:19.086 stealth_cds T sprint Fluffy_Pillow 79.3/100: 79% energy | 3.0/6: 50% combo_points bloodlust, temptation(2), master_of_subtlety, symbols_of_death, shadow_blades, potion_of_the_old_war
0:19.086 build G backstab Fluffy_Pillow 79.3/100: 79% energy | 3.0/6: 50% combo_points bloodlust, temptation(2), master_of_subtlety, sprint, symbols_of_death, shadow_blades, faster_than_light_trigger, potion_of_the_old_war
0:20.091 finish M eviscerate Fluffy_Pillow 58.6/100: 59% energy | 5.0/6: 83% combo_points bloodlust, temptation(2), master_of_subtlety, sprint, symbols_of_death, shadow_blades, faster_than_light_trigger, potion_of_the_old_war
0:21.097 stealth_cds R shadow_dance Fluffy_Pillow 77.9/100: 78% energy | 0.0/6: 0% combo_points bloodlust, temptation(2), master_of_subtlety, sprint, symbols_of_death, shadow_blades, finality_eviscerate(5), faster_than_light_trigger, potion_of_the_old_war
0:21.097 stealthed W symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points bloodlust, temptation(2), master_of_subtlety_aura, shadow_dance, sprint, symbols_of_death, shadow_blades, finality_eviscerate(5), faster_than_light_trigger, potion_of_the_old_war
0:21.097 stealthed Y shadowstrike Fluffy_Pillow 65.0/100: 65% energy | 0.0/6: 0% combo_points bloodlust, temptation(2), master_of_subtlety_aura, shadow_dance, sprint, symbols_of_death, shadow_blades, death, finality_eviscerate(5), faster_than_light_trigger, potion_of_the_old_war
0:22.102 stealthed Y shadowstrike Fluffy_Pillow 70.3/100: 70% energy | 3.0/6: 50% combo_points bloodlust, temptation(2), master_of_subtlety_aura, shadow_dance, vanish, subterfuge, sprint, symbols_of_death, shadow_blades, finality_eviscerate(5), potion_of_the_old_war
0:23.105 finish M eviscerate Fluffy_Pillow 75.6/100: 76% energy | 6.0/6: 100% combo_points bloodlust, temptation(2), master_of_subtlety_aura, shadow_dance, vanish, subterfuge, sprint, symbols_of_death, shadow_blades, finality_eviscerate(5)
0:24.109 stealthed Y shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points bloodlust, temptation(2), master_of_subtlety_aura, shadow_dance, vanish, subterfuge, sprint, symbols_of_death, shadow_blades
0:25.112 stealthed Y shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 4.0/6: 67% combo_points bloodlust, temptation(2), master_of_subtlety, shadow_dance, sprint, symbols_of_death, shadow_blades
0:26.116 finish M eviscerate Fluffy_Pillow 100.0/100: 100% energy | 6.0/6: 100% combo_points bloodlust, temptation(2), master_of_subtlety, sprint, symbols_of_death, shadow_blades
0:27.120 build G backstab Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points bloodlust, temptation(2), master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6)
0:28.124 build G backstab Fluffy_Pillow 79.3/100: 79% energy | 2.0/6: 33% combo_points bloodlust, temptation(2), master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6)
0:29.128 build G backstab Fluffy_Pillow 58.6/100: 59% energy | 4.0/6: 67% combo_points bloodlust, temptation(2), master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6)
0:30.131 finish M eviscerate Fluffy_Pillow 37.9/100: 38% energy | 6.0/6: 100% combo_points bloodlust, temptation(2), master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6)
0:31.137 stealth_cds R shadow_dance Fluffy_Pillow 57.2/100: 57% energy | 0.0/6: 0% combo_points bloodlust, temptation(2), symbols_of_death, shadow_blades
0:31.137 cds I use_item_ring_of_collapsing_futures Fluffy_Pillow 82.2/100: 82% energy | 0.0/6: 0% combo_points bloodlust, temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades
0:31.137 stealthed Y shadowstrike Fluffy_Pillow 82.2/100: 82% energy | 0.0/6: 0% combo_points bloodlust, temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades
0:32.141 stealthed Y shadowstrike Fluffy_Pillow 62.5/100: 63% energy | 3.0/6: 50% combo_points bloodlust, temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades
0:33.145 finish M eviscerate Fluffy_Pillow 67.8/100: 68% energy | 6.0/6: 100% combo_points bloodlust, temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades
0:34.148 stealthed Y shadowstrike Fluffy_Pillow 87.1/100: 87% energy | 0.0/6: 0% combo_points bloodlust, temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6)
0:35.151 stealthed Y shadowstrike Fluffy_Pillow 67.4/100: 67% energy | 3.0/6: 50% combo_points bloodlust, temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6)
0:36.156 finish L nightblade Fluffy_Pillow 47.7/100: 48% energy | 6.0/6: 100% combo_points bloodlust, temptation(3), master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6)
0:37.163 stealth_cds U shadow_dance Fluffy_Pillow 77.0/100: 77% energy | 0.0/6: 0% combo_points bloodlust, temptation(3), master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6)
0:37.163 stealthed W symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points bloodlust, temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6)
0:37.163 stealthed Y shadowstrike Fluffy_Pillow 65.0/100: 65% energy | 0.0/6: 0% combo_points bloodlust, temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, death, finality_eviscerate(6), finality_nightblade(6)
0:38.167 stealthed Y shadowstrike Fluffy_Pillow 45.3/100: 45% energy | 3.0/6: 50% combo_points bloodlust, temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6)
0:39.172 Waiting     0.700 sec 25.6/100: 26% energy | 6.0/6: 100% combo_points bloodlust, temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6)
0:39.872 finish M eviscerate Fluffy_Pillow 35.6/100: 36% energy | 6.0/6: 100% combo_points bloodlust, temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6)
0:40.877 stealthed Y shadowstrike Fluffy_Pillow 94.9/100: 95% energy | 0.0/6: 0% combo_points bloodlust, temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6)
0:41.882 finish M eviscerate Fluffy_Pillow 71.9/100: 72% energy | 5.0/6: 83% combo_points temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6)
0:42.884 stealth_cds U shadow_dance Fluffy_Pillow 87.9/100: 88% energy | 0.0/6: 0% combo_points temptation(3), master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(5), finality_nightblade(6)
0:42.884 stealthed Y shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(5), finality_nightblade(6)
0:43.888 stealthed Y shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 3.0/6: 50% combo_points temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(5), finality_nightblade(6)
0:44.894 finish M eviscerate Fluffy_Pillow 100.0/100: 100% energy | 6.0/6: 100% combo_points temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(5), finality_nightblade(6)
0:45.899 stealthed Y shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6)
0:46.906 stealthed Y shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 3.0/6: 50% combo_points temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6)
0:47.912 finish M eviscerate Fluffy_Pillow 77.0/100: 77% energy | 6.0/6: 100% combo_points temptation(3), master_of_subtlety, symbols_of_death, shadow_blades, finality_nightblade(6)
0:48.917 build G backstab Fluffy_Pillow 93.0/100: 93% energy | 0.0/6: 0% combo_points temptation(3), master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6)
0:49.922 build G backstab Fluffy_Pillow 69.0/100: 69% energy | 2.0/6: 33% combo_points temptation(3), master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6)
0:50.925 finish M eviscerate Fluffy_Pillow 45.0/100: 45% energy | 5.0/6: 83% combo_points temptation(3), master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6)
0:51.929 cds K goremaws_bite Fluffy_Pillow 61.0/100: 61% energy | 0.0/6: 0% combo_points temptation(3), master_of_subtlety, symbols_of_death, shadow_blades, finality_nightblade(6)
0:52.934 build G backstab Fluffy_Pillow 77.0/100: 77% energy | 3.0/6: 50% combo_points temptation(3), symbols_of_death, shadow_blades, goremaws_bite, finality_nightblade(6)
0:53.938 finish L nightblade Fluffy_Pillow 58.0/100: 58% energy | 5.0/6: 83% combo_points temptation(3), symbols_of_death, shadow_blades, goremaws_bite, finality_nightblade(6)
0:54.944 stealth_cds U shadow_dance Fluffy_Pillow 89.1/100: 89% energy | 1.0/6: 17% combo_points temptation(3), symbols_of_death, shadow_blades, goremaws_bite
0:54.944 stealthed W symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, goremaws_bite
0:54.944 stealthed Y shadowstrike Fluffy_Pillow 65.0/100: 65% energy | 1.0/6: 17% combo_points temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, goremaws_bite, death
0:55.947 stealthed Y shadowstrike Fluffy_Pillow 47.0/100: 47% energy | 4.0/6: 67% combo_points temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, goremaws_bite, recursive_strikes(2)
0:56.951 finish M eviscerate Fluffy_Pillow 54.0/100: 54% energy | 6.0/6: 100% combo_points temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, goremaws_bite, recursive_strikes(2)
0:57.955 stealthed Y shadowstrike Fluffy_Pillow 75.0/100: 75% energy | 0.0/6: 0% combo_points temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6), recursive_strikes(4)
0:58.960 stealthed Y shadowstrike Fluffy_Pillow 77.0/100: 77% energy | 2.0/6: 33% combo_points temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6), recursive_strikes(4)
0:59.964 finish M eviscerate Fluffy_Pillow 54.0/100: 54% energy | 5.0/6: 83% combo_points temptation(3), master_of_subtlety, symbols_of_death, finality_eviscerate(6), recursive_strikes(6)
1:00.968 stealth_cds U shadow_dance Fluffy_Pillow 70.0/100: 70% energy | 0.0/6: 0% combo_points temptation(3), master_of_subtlety, symbols_of_death, recursive_strikes(8)
1:00.968 stealthed Y shadowstrike Fluffy_Pillow 95.0/100: 95% energy | 0.0/6: 0% combo_points temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, recursive_strikes(8)
1:01.971 stealthed Y shadowstrike Fluffy_Pillow 72.0/100: 72% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, recursive_strikes(8)
1:02.976 finish M eviscerate Fluffy_Pillow 49.0/100: 49% energy | 5.0/6: 83% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, recursive_strikes(10)
1:03.980 stealthed Y shadowstrike Fluffy_Pillow 65.0/100: 65% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5), recursive_strikes(10)
1:04.985 stealthed Y shadowstrike Fluffy_Pillow 42.0/100: 42% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5), recursive_strikes(12)
1:05.989 Waiting     1.547 sec 19.0/100: 19% energy | 4.0/6: 67% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5), recursive_strikes(13)
1:07.536 finish M eviscerate Fluffy_Pillow 35.9/100: 36% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5), recursive_strikes(14)
1:08.539 stealth_cds V shadow_dance Fluffy_Pillow 51.9/100: 52% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, recursive_strikes(14)
1:08.539 stealthed Y shadowstrike Fluffy_Pillow 76.9/100: 77% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, recursive_strikes(14)
1:09.544 stealthed Y shadowstrike Fluffy_Pillow 53.9/100: 54% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, recursive_strikes(15)
1:10.547 Waiting     0.100 sec 30.9/100: 31% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, recursive_strikes(15)
1:10.647 finish L nightblade Fluffy_Pillow 32.0/100: 32% energy | 5.0/6: 83% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, recursive_strikes(15)
1:11.650 stealthed Y shadowstrike Fluffy_Pillow 58.0/100: 58% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(5)
1:12.655 Waiting     0.500 sec 35.0/100: 35% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(5)
1:13.155 stealthed Y shadowstrike Fluffy_Pillow 40.5/100: 41% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(5)
1:14.159 Waiting     1.684 sec 17.5/100: 17% energy | 4.0/6: 67% combo_points master_of_subtlety, symbols_of_death, finality_nightblade(5)
1:15.843 finish M eviscerate Fluffy_Pillow 35.9/100: 36% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death, finality_nightblade(5)
1:16.848 stealth_cds V shadow_dance Fluffy_Pillow 52.0/100: 52% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5), finality_nightblade(5)
1:16.848 stealthed Y shadowstrike Fluffy_Pillow 77.0/100: 77% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5), finality_nightblade(5)
1:17.852 stealthed Y shadowstrike Fluffy_Pillow 54.0/100: 54% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5), finality_nightblade(5)
1:18.857 cds J shadow_blades Fluffy_Pillow 56.0/100: 56% energy | 5.0/6: 83% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5), finality_nightblade(5)
1:18.857 cds H potion Fluffy_Pillow 56.0/100: 56% energy | 5.0/6: 83% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(5), finality_nightblade(5)
1:18.857 finish M eviscerate Fluffy_Pillow 56.0/100: 56% energy | 5.0/6: 83% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(5), finality_nightblade(5), potion_of_the_old_war
1:19.860 stealthed Y shadowstrike Fluffy_Pillow 72.0/100: 72% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(5), potion_of_the_old_war
1:20.864 stealthed Y shadowstrike Fluffy_Pillow 49.0/100: 49% energy | 3.0/6: 50% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(5), potion_of_the_old_war
1:21.868 Waiting     0.800 sec 26.0/100: 26% energy | 6.0/6: 100% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_nightblade(5), potion_of_the_old_war
1:22.668 finish L nightblade Fluffy_Pillow 34.7/100: 35% energy | 6.0/6: 100% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_nightblade(5), potion_of_the_old_war
1:23.671 stealth_cds V shadow_dance Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, shadow_blades, potion_of_the_old_war
1:23.671 stealthed W symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, potion_of_the_old_war
1:23.671 stealthed Y shadowstrike Fluffy_Pillow 65.0/100: 65% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, death, potion_of_the_old_war
1:24.673 stealthed Y shadowstrike Fluffy_Pillow 42.0/100: 42% energy | 3.0/6: 50% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, potion_of_the_old_war
1:25.676 Waiting     1.550 sec 19.0/100: 19% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, potion_of_the_old_war
1:27.226 finish M eviscerate Fluffy_Pillow 35.9/100: 36% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, potion_of_the_old_war
1:28.230 stealthed Y shadowstrike Fluffy_Pillow 51.9/100: 52% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), potion_of_the_old_war
1:29.236 Waiting     2.100 sec 29.0/100: 29% energy | 3.0/6: 50% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), potion_of_the_old_war
1:31.336 build G backstab Fluffy_Pillow 52.0/100: 52% energy | 4.0/6: 67% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), potion_of_the_old_war
1:32.340 Waiting     0.700 sec 28.0/100: 28% energy | 6.0/6: 100% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), potion_of_the_old_war
1:33.040 finish M eviscerate Fluffy_Pillow 35.6/100: 36% energy | 6.0/6: 100% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), potion_of_the_old_war
1:34.044 stealth_cds V shadow_dance Fluffy_Pillow 51.6/100: 52% energy | 0.0/6: 0% combo_points symbols_of_death, shadow_blades, potion_of_the_old_war
1:34.138 stealthed Y shadowstrike Fluffy_Pillow 77.7/100: 78% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, potion_of_the_old_war
1:35.143 stealthed Y shadowstrike Fluffy_Pillow 54.7/100: 55% energy | 3.0/6: 50% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, potion_of_the_old_war
1:36.148 Waiting     0.400 sec 31.7/100: 32% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, potion_of_the_old_war
1:36.548 finish M eviscerate Fluffy_Pillow 36.1/100: 36% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, potion_of_the_old_war
1:37.551 stealthed Y shadowstrike Fluffy_Pillow 52.1/100: 52% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), potion_of_the_old_war
1:38.555 Waiting     0.600 sec 29.1/100: 29% energy | 5.0/6: 83% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), potion_of_the_old_war
1:39.155 finish M eviscerate Fluffy_Pillow 35.6/100: 36% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), potion_of_the_old_war
1:40.162 build G backstab Fluffy_Pillow 51.7/100: 52% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, shadow_blades, potion_of_the_old_war
1:41.167 Waiting     2.200 sec 27.7/100: 28% energy | 2.0/6: 33% combo_points master_of_subtlety, symbols_of_death, shadow_blades, potion_of_the_old_war
1:43.367 build G backstab Fluffy_Pillow 51.8/100: 52% energy | 3.0/6: 50% combo_points master_of_subtlety, symbols_of_death, shadow_blades, potion_of_the_old_war
1:44.372 finish L nightblade Fluffy_Pillow 27.8/100: 28% energy | 5.0/6: 83% combo_points symbols_of_death, shadow_blades
1:45.377 build G backstab Fluffy_Pillow 53.8/100: 54% energy | 1.0/6: 17% combo_points symbols_of_death, shadow_blades, finality_nightblade(5)
1:46.383 Waiting     2.000 sec 29.8/100: 30% energy | 3.0/6: 50% combo_points symbols_of_death, shadow_blades, finality_nightblade(5)
1:48.383 build G backstab Fluffy_Pillow 51.7/100: 52% energy | 3.0/6: 50% combo_points symbols_of_death, shadow_blades, finality_nightblade(5)
1:49.386 Waiting     0.700 sec 27.7/100: 28% energy | 5.0/6: 83% combo_points symbols_of_death, shadow_blades, finality_nightblade(5)
1:50.086 finish M eviscerate Fluffy_Pillow 35.4/100: 35% energy | 6.0/6: 100% combo_points symbols_of_death, shadow_blades, finality_nightblade(5), recursive_strikes(2)
1:51.091 stealth_cds V shadow_dance Fluffy_Pillow 51.4/100: 51% energy | 0.0/6: 0% combo_points symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(5), recursive_strikes(2)
1:51.091 stealthed Y shadowstrike Fluffy_Pillow 76.4/100: 76% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(5), recursive_strikes(2)
1:52.096 stealthed Y shadowstrike Fluffy_Pillow 78.4/100: 78% energy | 3.0/6: 50% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(5), recursive_strikes(4)
1:53.100 finish M eviscerate Fluffy_Pillow 80.4/100: 80% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(5), recursive_strikes(4)
1:54.104 stealthed W symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(5), recursive_strikes(6)
1:54.104 stealthed Y shadowstrike Fluffy_Pillow 65.0/100: 65% energy | 1.0/6: 17% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, death, finality_nightblade(5), recursive_strikes(6)
1:55.108 stealthed Y shadowstrike Fluffy_Pillow 42.0/100: 42% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(5), recursive_strikes(8)
1:56.112 Waiting     0.647 sec 19.0/100: 19% energy | 6.0/6: 100% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_nightblade(5), recursive_strikes(8)
1:56.759 finish L nightblade Fluffy_Pillow 26.1/100: 26% energy | 6.0/6: 100% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_nightblade(5), recursive_strikes(10)
1:57.766 cds K goremaws_bite Fluffy_Pillow 52.1/100: 52% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, shadow_blades, recursive_strikes(10)
1:58.771 build G backstab Fluffy_Pillow 68.1/100: 68% energy | 4.0/6: 67% combo_points master_of_subtlety, symbols_of_death, shadow_blades, goremaws_bite, recursive_strikes(12)
1:59.776 finish M eviscerate Fluffy_Pillow 49.1/100: 49% energy | 6.0/6: 100% combo_points master_of_subtlety, symbols_of_death, shadow_blades, goremaws_bite, recursive_strikes(12)
2:00.779 stealth_cds V shadow_dance Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, shadow_blades, goremaws_bite, finality_eviscerate(6), recursive_strikes(14)
2:00.779 stealthed Y shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, goremaws_bite, finality_eviscerate(6), recursive_strikes(14)
2:01.783 stealthed Y shadowstrike Fluffy_Pillow 82.0/100: 82% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, goremaws_bite, finality_eviscerate(6), recursive_strikes(15)
2:02.786 finish M eviscerate Fluffy_Pillow 64.0/100: 64% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, goremaws_bite, finality_eviscerate(6), recursive_strikes(15)
2:03.791 stealthed Y shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, recursive_strikes(15)
2:04.794 stealthed Y shadowstrike Fluffy_Pillow 77.0/100: 77% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, recursive_strikes(15)
2:05.799 build G backstab Fluffy_Pillow 54.0/100: 54% energy | 4.0/6: 67% combo_points master_of_subtlety, symbols_of_death
2:06.803 Waiting     0.500 sec 30.0/100: 30% energy | 6.0/6: 100% combo_points master_of_subtlety, symbols_of_death
2:07.303 finish M eviscerate Fluffy_Pillow 35.5/100: 35% energy | 6.0/6: 100% combo_points master_of_subtlety, symbols_of_death
2:08.308 stealth_cds V shadow_dance Fluffy_Pillow 51.5/100: 51% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(6)
2:08.308 stealthed Y shadowstrike Fluffy_Pillow 76.5/100: 76% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6)
2:09.313 stealthed Y shadowstrike Fluffy_Pillow 78.5/100: 78% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6)
2:10.316 stealthed Y shadowstrike Fluffy_Pillow 55.5/100: 55% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6)
2:11.319 Waiting     0.300 sec 32.5/100: 32% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6)
2:11.619 finish M eviscerate Fluffy_Pillow 35.8/100: 36% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6)
2:12.624 stealthed Y shadowstrike Fluffy_Pillow 51.8/100: 52% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
2:13.629 Waiting     2.100 sec 28.8/100: 29% energy | 2.0/6: 33% combo_points master_of_subtlety, symbols_of_death
2:15.729 stealth_cds S vanish Fluffy_Pillow 51.8/100: 52% energy | 2.0/6: 33% combo_points master_of_subtlety, symbols_of_death
2:15.729 stealthed Y shadowstrike Fluffy_Pillow 76.8/100: 77% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, vanish, symbols_of_death
2:16.733 finish M eviscerate Fluffy_Pillow 53.8/100: 54% energy | 5.0/6: 83% combo_points master_of_subtlety_aura, vanish, subterfuge, symbols_of_death
2:17.737 stealthed Y shadowstrike Fluffy_Pillow 69.8/100: 70% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, vanish, subterfuge, symbols_of_death, finality_eviscerate(5)
2:18.741 build G backstab Fluffy_Pillow 71.8/100: 72% energy | 2.0/6: 33% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5)
2:19.746 stealth_cds T sprint Fluffy_Pillow 47.8/100: 48% energy | 3.0/6: 50% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5)
2:19.746 Waiting     0.300 sec 47.8/100: 48% energy | 3.0/6: 50% combo_points master_of_subtlety, sprint, symbols_of_death, finality_eviscerate(5), faster_than_light_trigger
2:20.046 build G backstab Fluffy_Pillow 51.1/100: 51% energy | 3.0/6: 50% combo_points master_of_subtlety, sprint, symbols_of_death, finality_eviscerate(5), faster_than_light_trigger
2:21.049 Waiting     1.700 sec 27.1/100: 27% energy | 4.0/6: 67% combo_points master_of_subtlety, sprint, symbols_of_death, finality_eviscerate(5), faster_than_light_trigger
2:22.749 finish L nightblade Fluffy_Pillow 70.7/100: 71% energy | 5.0/6: 83% combo_points master_of_subtlety_aura, vanish, subterfuge, sprint, symbols_of_death, finality_eviscerate(5)
2:23.754 stealthed Y shadowstrike Fluffy_Pillow 96.7/100: 97% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, vanish, subterfuge, sprint, symbols_of_death, finality_eviscerate(5), finality_nightblade(5)
2:24.758 stealthed W symbols_of_death Fluffy_Pillow 98.7/100: 99% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, vanish, subterfuge, sprint, symbols_of_death, finality_eviscerate(5), finality_nightblade(5)
2:24.758 stealthed Y shadowstrike Fluffy_Pillow 63.7/100: 64% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, vanish, subterfuge, sprint, symbols_of_death, death, finality_eviscerate(5), finality_nightblade(5)
2:25.760 build G backstab Fluffy_Pillow 65.7/100: 66% energy | 4.0/6: 67% combo_points master_of_subtlety, sprint, symbols_of_death, finality_eviscerate(5), finality_nightblade(5)
2:26.763 finish M eviscerate Fluffy_Pillow 41.7/100: 42% energy | 5.0/6: 83% combo_points master_of_subtlety, sprint, symbols_of_death, finality_eviscerate(5), finality_nightblade(5)
2:27.769 stealth_cds V shadow_dance Fluffy_Pillow 57.7/100: 58% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, finality_nightblade(5)
2:27.769 stealthed Y shadowstrike Fluffy_Pillow 82.7/100: 83% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(5)
2:28.772 stealthed Y shadowstrike Fluffy_Pillow 84.7/100: 85% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(5)
2:29.776 finish M eviscerate Fluffy_Pillow 86.7/100: 87% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(5)
2:30.781 stealthed Y shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6), finality_nightblade(5)
2:31.786 stealthed Y shadowstrike Fluffy_Pillow 77.0/100: 77% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6), finality_nightblade(5)
2:32.792 build G backstab Fluffy_Pillow 54.0/100: 54% energy | 4.0/6: 67% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(6), finality_nightblade(5)
2:33.799 Waiting     0.200 sec 30.1/100: 30% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(6), finality_nightblade(5)
2:33.999 finish L nightblade Fluffy_Pillow 32.3/100: 32% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(6), finality_nightblade(5)
2:35.003 stealth_cds V shadow_dance Fluffy_Pillow 58.3/100: 58% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(6)
2:35.003 stealthed Y shadowstrike Fluffy_Pillow 83.3/100: 83% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6)
2:36.007 stealthed Y shadowstrike Fluffy_Pillow 60.3/100: 60% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6)
2:37.010 finish M eviscerate Fluffy_Pillow 37.2/100: 37% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6)
2:38.015 stealthed Y shadowstrike Fluffy_Pillow 53.2/100: 53% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
2:39.019 Waiting     0.900 sec 30.2/100: 30% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
2:39.919 stealthed Y shadowstrike Fluffy_Pillow 40.1/100: 40% energy | 3.0/6: 50% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
2:40.923 Waiting     1.720 sec 17.1/100: 17% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death
2:42.643 finish M eviscerate Fluffy_Pillow 35.9/100: 36% energy | 6.0/6: 100% combo_points master_of_subtlety, symbols_of_death
2:43.647 build G backstab Fluffy_Pillow 51.9/100: 52% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(6)
2:44.651 Waiting     1.300 sec 27.9/100: 28% energy | 1.0/6: 17% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(6)
2:45.951 stealth_cds V shadow_dance Fluffy_Pillow 42.2/100: 42% energy | 1.0/6: 17% combo_points symbols_of_death, finality_eviscerate(6)
2:46.138 stealthed Y shadowstrike Fluffy_Pillow 69.2/100: 69% energy | 1.0/6: 17% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6)
2:47.144 stealthed Y shadowstrike Fluffy_Pillow 46.3/100: 46% energy | 3.0/6: 50% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6)
2:48.148 finish M eviscerate Fluffy_Pillow 48.3/100: 48% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6), recursive_strikes(3)
2:49.152 stealthed W symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, recursive_strikes(4)
2:49.152 stealthed Y shadowstrike Fluffy_Pillow 65.0/100: 65% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, death, recursive_strikes(4)
2:50.154 stealthed Y shadowstrike Fluffy_Pillow 42.0/100: 42% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, recursive_strikes(4)
2:51.159 Waiting     1.548 sec 19.0/100: 19% energy | 4.0/6: 67% combo_points master_of_subtlety, symbols_of_death, recursive_strikes(5)
2:52.707 finish M eviscerate Fluffy_Pillow 35.9/100: 36% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death, recursive_strikes(7)
2:53.712 build G backstab Fluffy_Pillow 52.0/100: 52% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5), recursive_strikes(7)
2:54.716 Waiting     2.200 sec 28.0/100: 28% energy | 1.0/6: 17% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5), recursive_strikes(8)
2:56.916 build G backstab Fluffy_Pillow 52.1/100: 52% energy | 1.0/6: 17% combo_points symbols_of_death, finality_eviscerate(5), recursive_strikes(10)
2:57.919 Waiting     2.100 sec 28.0/100: 28% energy | 3.0/6: 50% combo_points symbols_of_death, finality_eviscerate(5), recursive_strikes(12)
3:00.019 build G backstab Fluffy_Pillow 51.0/100: 51% energy | 3.0/6: 50% combo_points symbols_of_death, finality_eviscerate(5), recursive_strikes(14)
3:01.025 finish L nightblade Fluffy_Pillow 27.1/100: 27% energy | 5.0/6: 83% combo_points symbols_of_death, finality_eviscerate(5), recursive_strikes(15)
3:02.030 cds K goremaws_bite Fluffy_Pillow 53.1/100: 53% energy | 0.0/6: 0% combo_points symbols_of_death, finality_eviscerate(5), finality_nightblade(5), recursive_strikes(15)
3:03.036 build G backstab Fluffy_Pillow 69.1/100: 69% energy | 3.0/6: 50% combo_points symbols_of_death, goremaws_bite, finality_eviscerate(5), finality_nightblade(5)
3:04.040 cds J shadow_blades Fluffy_Pillow 50.1/100: 50% energy | 4.0/6: 67% combo_points symbols_of_death, goremaws_bite, finality_eviscerate(5), finality_nightblade(5)
3:04.040 Waiting     0.100 sec 50.1/100: 50% energy | 4.0/6: 67% combo_points symbols_of_death, shadow_blades, goremaws_bite, finality_eviscerate(5), finality_nightblade(5)
3:04.140 build G backstab Fluffy_Pillow 51.2/100: 51% energy | 4.0/6: 67% combo_points symbols_of_death, shadow_blades, goremaws_bite, finality_eviscerate(5), finality_nightblade(5)
3:05.143 Waiting     0.300 sec 32.2/100: 32% energy | 6.0/6: 100% combo_points symbols_of_death, shadow_blades, goremaws_bite, finality_eviscerate(5), finality_nightblade(5)
3:05.443 finish M eviscerate Fluffy_Pillow 35.5/100: 35% energy | 6.0/6: 100% combo_points symbols_of_death, shadow_blades, goremaws_bite, finality_eviscerate(5), finality_nightblade(5)
3:06.448 stealth_cds V shadow_dance Fluffy_Pillow 96.5/100: 96% energy | 1.0/6: 17% combo_points symbols_of_death, shadow_blades, goremaws_bite, finality_nightblade(5)
3:06.448 stealthed W symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, goremaws_bite, finality_nightblade(5)
3:06.448 stealthed Y shadowstrike Fluffy_Pillow 65.0/100: 65% energy | 1.0/6: 17% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, goremaws_bite, death, finality_nightblade(5)
3:07.453 stealthed Y shadowstrike Fluffy_Pillow 47.0/100: 47% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, goremaws_bite, finality_nightblade(5)
3:08.460 Waiting     0.600 sec 29.0/100: 29% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(5)
3:09.060 finish M eviscerate Fluffy_Pillow 35.6/100: 36% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(5)
3:10.063 stealthed Y shadowstrike Fluffy_Pillow 51.6/100: 52% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(5)
3:11.067 stealthed Y shadowstrike Fluffy_Pillow 53.6/100: 54% energy | 3.0/6: 50% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(5), recursive_strikes(3)
3:12.072 finish L nightblade Fluffy_Pillow 30.6/100: 31% energy | 6.0/6: 100% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(5), recursive_strikes(5)
3:13.078 stealth_cds V shadow_dance Fluffy_Pillow 56.6/100: 57% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), recursive_strikes(5)
3:13.078 stealthed Y shadowstrike Fluffy_Pillow 81.6/100: 82% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), recursive_strikes(5)
3:14.085 stealthed Y shadowstrike Fluffy_Pillow 58.7/100: 59% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), recursive_strikes(7)
3:15.090 finish M eviscerate Fluffy_Pillow 60.7/100: 61% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), recursive_strikes(7)
3:16.092 stealthed Y shadowstrike Fluffy_Pillow 76.6/100: 77% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, recursive_strikes(9)
3:17.098 stealthed Y shadowstrike Fluffy_Pillow 78.7/100: 79% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, recursive_strikes(11)
3:18.103 finish M eviscerate Fluffy_Pillow 55.7/100: 56% energy | 6.0/6: 100% combo_points master_of_subtlety, symbols_of_death, shadow_blades, recursive_strikes(11)
3:19.108 build G backstab Fluffy_Pillow 71.7/100: 72% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), recursive_strikes(13)
3:20.113 Waiting     0.400 sec 47.7/100: 48% energy | 2.0/6: 33% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), recursive_strikes(13)
3:20.513 build G backstab Fluffy_Pillow 52.1/100: 52% energy | 3.0/6: 50% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), recursive_strikes(15)
3:21.519 Waiting     0.700 sec 28.1/100: 28% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), recursive_strikes(15)
3:22.219 finish M eviscerate Fluffy_Pillow 35.8/100: 36% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), recursive_strikes(15)
3:23.223 stealth_cds V shadow_dance Fluffy_Pillow 51.8/100: 52% energy | 0.0/6: 0% combo_points symbols_of_death, shadow_blades, recursive_strikes(15)
3:23.223 stealthed Y shadowstrike Fluffy_Pillow 76.8/100: 77% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, recursive_strikes(15)
3:24.227 stealthed Y shadowstrike Fluffy_Pillow 53.8/100: 54% energy | 3.0/6: 50% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, recursive_strikes(15)
3:25.232 Waiting     0.400 sec 30.8/100: 31% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades
3:25.632 finish M eviscerate Fluffy_Pillow 35.2/100: 35% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades
3:26.638 stealthed Y shadowstrike Fluffy_Pillow 51.2/100: 51% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6)
3:27.642 Waiting     2.100 sec 28.2/100: 28% energy | 3.0/6: 50% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6)
3:29.742 build G backstab Fluffy_Pillow 51.2/100: 51% energy | 4.0/6: 67% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6)
3:30.748 Waiting     0.800 sec 27.2/100: 27% energy | 6.0/6: 100% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6)
3:31.548 finish M eviscerate Fluffy_Pillow 36.0/100: 36% energy | 6.0/6: 100% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6)
3:32.554 build G backstab Fluffy_Pillow 92.0/100: 92% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, shadow_blades
3:33.559 build G backstab Fluffy_Pillow 68.0/100: 68% energy | 4.0/6: 67% combo_points symbols_of_death, shadow_blades
3:34.565 finish L nightblade Fluffy_Pillow 44.0/100: 44% energy | 6.0/6: 100% combo_points symbols_of_death, shadow_blades
3:35.570 stealth_cds V shadow_dance Fluffy_Pillow 70.0/100: 70% energy | 0.0/6: 0% combo_points symbols_of_death, shadow_blades, finality_nightblade(6)
3:35.570 stealthed Y shadowstrike Fluffy_Pillow 95.0/100: 95% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6)
3:36.575 stealthed Y shadowstrike Fluffy_Pillow 72.0/100: 72% energy | 3.0/6: 50% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6)
3:37.580 finish M eviscerate Fluffy_Pillow 49.0/100: 49% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6)
3:38.585 stealthed Y shadowstrike Fluffy_Pillow 65.1/100: 65% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6)
3:39.590 stealthed Y shadowstrike Fluffy_Pillow 42.1/100: 42% energy | 3.0/6: 50% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6)
3:40.593 Waiting     1.542 sec 19.1/100: 19% energy | 6.0/6: 100% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6)
3:42.135 finish M eviscerate Fluffy_Pillow 35.9/100: 36% energy | 6.0/6: 100% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6), recursive_strikes(2)
3:43.138 stealth_cds V shadow_dance Fluffy_Pillow 51.9/100: 52% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_nightblade(6), recursive_strikes(2)
3:43.138 stealthed W symbols_of_death Fluffy_Pillow 76.9/100: 77% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6), recursive_strikes(2)
3:43.138 stealthed Y shadowstrike Fluffy_Pillow 41.9/100: 42% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, death, finality_nightblade(6), recursive_strikes(2)
3:44.142 stealthed Y shadowstrike Fluffy_Pillow 43.9/100: 44% energy | 3.0/6: 50% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6), recursive_strikes(4)
3:45.147 Waiting     1.370 sec 20.9/100: 21% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6), recursive_strikes(6)
3:46.517 finish M eviscerate Fluffy_Pillow 36.0/100: 36% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6), recursive_strikes(6)
3:47.521 stealthed Y shadowstrike Fluffy_Pillow 52.0/100: 52% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6), recursive_strikes(8)
3:48.525 build G backstab Fluffy_Pillow 54.0/100: 54% energy | 4.0/6: 67% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6), recursive_strikes(10)
3:49.529 finish L nightblade Fluffy_Pillow 29.9/100: 30% energy | 6.0/6: 100% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6), recursive_strikes(10)
3:50.534 build G backstab Fluffy_Pillow 56.0/100: 56% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), recursive_strikes(12)
3:51.538 Waiting     1.800 sec 32.0/100: 32% energy | 3.0/6: 50% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), recursive_strikes(14)
3:53.338 build G backstab Fluffy_Pillow 51.7/100: 52% energy | 3.0/6: 50% combo_points symbols_of_death, finality_eviscerate(6), recursive_strikes(15)
3:54.341 Waiting     0.700 sec 27.7/100: 28% energy | 4.0/6: 67% combo_points symbols_of_death, finality_eviscerate(6), recursive_strikes(15)
3:55.041 finish M eviscerate Fluffy_Pillow 35.3/100: 35% energy | 5.0/6: 83% combo_points symbols_of_death, finality_eviscerate(6), recursive_strikes(15)
3:56.046 stealth_cds V shadow_dance Fluffy_Pillow 51.3/100: 51% energy | 0.0/6: 0% combo_points symbols_of_death, recursive_strikes(15)
3:56.046 stealthed Y shadowstrike Fluffy_Pillow 76.3/100: 76% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, recursive_strikes(15)
3:57.051 stealthed Y shadowstrike Fluffy_Pillow 78.4/100: 78% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
3:58.056 stealthed Y shadowstrike Fluffy_Pillow 55.4/100: 55% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
3:59.060 Waiting     0.300 sec 32.4/100: 32% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
3:59.360 finish M eviscerate Fluffy_Pillow 35.6/100: 36% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
4:00.364 stealthed Y shadowstrike Fluffy_Pillow 51.6/100: 52% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6)
4:01.369 Waiting     2.100 sec 28.7/100: 29% energy | 3.0/6: 50% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(6)
4:03.469 build G backstab Fluffy_Pillow 51.7/100: 52% energy | 3.0/6: 50% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(6)
4:04.471 Waiting     1.800 sec 27.6/100: 28% energy | 4.0/6: 67% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(6)
4:06.271 finish M eviscerate Fluffy_Pillow 47.4/100: 47% energy | 5.0/6: 83% combo_points symbols_of_death, finality_eviscerate(6)
4:07.275 cds K goremaws_bite Fluffy_Pillow 63.4/100: 63% energy | 0.0/6: 0% combo_points symbols_of_death
4:08.279 build G backstab Fluffy_Pillow 79.4/100: 79% energy | 3.0/6: 50% combo_points symbols_of_death, goremaws_bite
4:09.285 build G backstab Fluffy_Pillow 60.4/100: 60% energy | 4.0/6: 67% combo_points symbols_of_death, goremaws_bite
4:10.290 finish L nightblade Fluffy_Pillow 41.4/100: 41% energy | 5.0/6: 83% combo_points symbols_of_death, goremaws_bite
4:11.294 stealth_cds V shadow_dance Fluffy_Pillow 72.4/100: 72% energy | 0.0/6: 0% combo_points symbols_of_death, goremaws_bite, finality_nightblade(5)
4:11.294 stealthed W symbols_of_death Fluffy_Pillow 97.4/100: 97% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, goremaws_bite, finality_nightblade(5)
4:11.294 stealthed Y shadowstrike Fluffy_Pillow 62.4/100: 62% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, goremaws_bite, death, finality_nightblade(5)
4:12.299 stealthed Y shadowstrike Fluffy_Pillow 44.4/100: 44% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, goremaws_bite, finality_nightblade(5)
4:13.302 Waiting     0.800 sec 26.4/100: 26% energy | 5.0/6: 83% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(5)
4:14.102 finish M eviscerate Fluffy_Pillow 35.1/100: 35% energy | 5.0/6: 83% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(5)
4:15.106 stealthed Y shadowstrike Fluffy_Pillow 51.1/100: 51% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5), finality_nightblade(5), recursive_strikes(3)
4:16.110 Waiting     2.100 sec 28.1/100: 28% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5), finality_nightblade(5), recursive_strikes(3)
4:18.210 stealth_cds S vanish Fluffy_Pillow 51.1/100: 51% energy | 3.0/6: 50% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5), finality_nightblade(5), recursive_strikes(5)
4:18.210 stealthed Y shadowstrike Fluffy_Pillow 76.1/100: 76% energy | 3.0/6: 50% combo_points master_of_subtlety_aura, vanish, symbols_of_death, finality_eviscerate(5), finality_nightblade(5), recursive_strikes(5)
4:19.216 finish M eviscerate Fluffy_Pillow 53.2/100: 53% energy | 5.0/6: 83% combo_points master_of_subtlety_aura, vanish, subterfuge, symbols_of_death, finality_eviscerate(5), finality_nightblade(5), recursive_strikes(7)
4:20.219 stealthed Y shadowstrike Fluffy_Pillow 69.2/100: 69% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, vanish, subterfuge, symbols_of_death, finality_nightblade(5), recursive_strikes(8)
4:21.225 stealth_cds T sprint Fluffy_Pillow 71.2/100: 71% energy | 3.0/6: 50% combo_points master_of_subtlety, symbols_of_death, finality_nightblade(5), recursive_strikes(9)
4:21.225 build G backstab Fluffy_Pillow 71.2/100: 71% energy | 3.0/6: 50% combo_points master_of_subtlety, sprint, symbols_of_death, finality_nightblade(5), faster_than_light_trigger, recursive_strikes(9)
4:22.230 Waiting     0.400 sec 47.2/100: 47% energy | 4.0/6: 67% combo_points master_of_subtlety, sprint, symbols_of_death, finality_nightblade(5), faster_than_light_trigger, recursive_strikes(9)
4:22.630 build G backstab Fluffy_Pillow 51.6/100: 52% energy | 4.0/6: 67% combo_points master_of_subtlety, sprint, symbols_of_death, finality_nightblade(5), faster_than_light_trigger, recursive_strikes(9)
4:23.634 finish L nightblade Fluffy_Pillow 27.6/100: 28% energy | 5.0/6: 83% combo_points master_of_subtlety, sprint, symbols_of_death, finality_nightblade(5), faster_than_light_trigger, recursive_strikes(9)
4:24.639 stealthed Y shadowstrike Fluffy_Pillow 78.6/100: 79% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, vanish, subterfuge, sprint, symbols_of_death, recursive_strikes(10)
4:25.643 stealthed Y shadowstrike Fluffy_Pillow 55.6/100: 56% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, vanish, subterfuge, sprint, symbols_of_death, recursive_strikes(10)
4:26.646 Waiting     0.600 sec 32.6/100: 33% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, vanish, subterfuge, sprint, symbols_of_death, recursive_strikes(12)
4:27.246 build G backstab Fluffy_Pillow 64.1/100: 64% energy | 4.0/6: 67% combo_points master_of_subtlety, sprint, symbols_of_death, recursive_strikes(12)
4:28.251 finish M eviscerate Fluffy_Pillow 40.1/100: 40% energy | 6.0/6: 100% combo_points master_of_subtlety, sprint, symbols_of_death, recursive_strikes(15)
4:29.257 stealth_cds V shadow_dance Fluffy_Pillow 96.2/100: 96% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(6), recursive_strikes(15)
4:29.257 stealthed W symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6), recursive_strikes(15)
4:29.257 stealthed Y shadowstrike Fluffy_Pillow 65.0/100: 65% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, death, finality_eviscerate(6), recursive_strikes(15)
4:30.262 stealthed Y shadowstrike Fluffy_Pillow 67.0/100: 67% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6), recursive_strikes(15)
4:31.266 stealthed Y shadowstrike Fluffy_Pillow 44.0/100: 44% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6), recursive_strikes(15)
4:32.269 Waiting     1.365 sec 21.0/100: 21% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6), recursive_strikes(15)
4:33.634 finish M eviscerate Fluffy_Pillow 35.9/100: 36% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6), recursive_strikes(15)
4:34.640 build G backstab Fluffy_Pillow 52.0/100: 52% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, recursive_strikes(15)
4:35.645 Waiting     2.200 sec 28.0/100: 28% energy | 1.0/6: 17% combo_points master_of_subtlety, symbols_of_death, recursive_strikes(15)
4:37.845 build G backstab Fluffy_Pillow 52.1/100: 52% energy | 2.0/6: 33% combo_points master_of_subtlety, symbols_of_death, recursive_strikes(15)
4:38.850 Waiting     1.900 sec 28.1/100: 28% energy | 3.0/6: 50% combo_points master_of_subtlety, symbols_of_death, recursive_strikes(15)
4:40.750 cds J shadow_blades Fluffy_Pillow 48.9/100: 49% energy | 4.0/6: 67% combo_points symbols_of_death, recursive_strikes(15)
4:40.750 Waiting     0.200 sec 48.9/100: 49% energy | 4.0/6: 67% combo_points symbols_of_death, shadow_blades, recursive_strikes(15)
4:40.950 build G backstab Fluffy_Pillow 51.1/100: 51% energy | 4.0/6: 67% combo_points symbols_of_death, shadow_blades, recursive_strikes(15)
4:41.956 finish L nightblade Fluffy_Pillow 27.1/100: 27% energy | 6.0/6: 100% combo_points symbols_of_death, shadow_blades, recursive_strikes(15)
4:42.961 stealth_cds V shadow_dance Fluffy_Pillow 53.1/100: 53% energy | 0.0/6: 0% combo_points symbols_of_death, shadow_blades, finality_nightblade(6)
4:42.961 stealthed Y shadowstrike Fluffy_Pillow 78.1/100: 78% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6)
4:43.965 stealthed Y shadowstrike Fluffy_Pillow 55.1/100: 55% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6)
4:44.971 Waiting     0.300 sec 32.1/100: 32% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6)
4:45.271 finish M eviscerate Fluffy_Pillow 35.4/100: 35% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6)
4:46.275 stealthed Y shadowstrike Fluffy_Pillow 51.4/100: 51% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6)
4:47.278 stealthed Y shadowstrike Fluffy_Pillow 53.4/100: 53% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6)
4:48.282 Waiting     0.500 sec 30.4/100: 30% energy | 6.0/6: 100% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6)
4:48.782 finish M eviscerate Fluffy_Pillow 35.9/100: 36% energy | 6.0/6: 100% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6)
4:49.787 stealth_cds V shadow_dance Fluffy_Pillow 51.9/100: 52% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_nightblade(6)
4:49.787 stealthed Y shadowstrike Fluffy_Pillow 76.9/100: 77% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6)
4:50.790 stealthed Y shadowstrike Fluffy_Pillow 78.9/100: 79% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6)
4:51.796 finish M eviscerate Fluffy_Pillow 80.9/100: 81% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6)
4:52.800 stealthed W symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6)
4:52.800 stealthed Y shadowstrike Fluffy_Pillow 65.0/100: 65% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, death, finality_eviscerate(6), finality_nightblade(6)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 8806 8481 0
Agility 32993 31287 20768 (13012)
Stamina 48391 48391 28183
Intellect 5325 5000 0
Spirit 0 0 0
Health 2903460 2903460 0
Energy 100 100 0
Combo Points 6 6 0
Crit 23.64% 23.64% 5456
Haste 9.55% 9.55% 3581
Damage / Heal Versatility 9.03% 8.23% 3909
Attack Power 32993 31287 0
Mastery 80.81% 80.81% 8510
Armor 2297 2297 2297
Run Speed 8 0 0

Gear

Source Slot Average Item Level: 891.00
Local Head Cowl of Fright
ilevel: 885, stats: { 300 Armor, +2829 Sta, +1886 AgiInt, +1015 Mastery, +547 Crit, +1076 unknown }
Local Neck Sea Fan Pendant
ilevel: 880, stats: { +1519 Sta, +1633 Vers, +965 Mastery }, enchant: mark_of_the_hidden_satyr
Local Shoulders Steelgazer Hide Mantle
ilevel: 880, stats: { 273 Armor, +1351 AgiInt, +2027 Sta, +673 Haste, +476 Vers, +771 unknown }
Local Shirt Common Gray Shirt
ilevel: 1
Local Chest Biornskin Vest
ilevel: 890, stats: { 376 Armor, +1977 AgiInt, +2965 Sta, +1034 Crit, +557 Mastery }
Local Waist Strand of Whelk Shells
ilevel: 880, stats: { 205 Armor, +2026 Sta, +1351 AgiInt, +673 Haste, +476 Mastery }, gems: { +150 Mastery }
Local Legs Legwraps of Unworthy Souls
ilevel: 880, stats: { 318 Armor, +2701 Sta, +1801 AgiInt, +964 Mastery, +570 Haste }
Local Feet Shadow Satyr's Walk
ilevel: 910, stats: { 276 Armor, +2680 Sta, +1786 Agi, +827 Haste, +459 Mastery }
Local Wrists Denial of the Half-Giants
ilevel: 910, stats: { 176 Armor, +2010 Sta, +1340 Agi, +276 Crit, +689 Mastery }
Local Hands Cruel Vice Grips
ilevel: 885, stats: { 231 Armor, +2122 Sta, +1415 AgiInt, +686 Crit, +485 Mastery }
Local Finger1 Grubby Silver Ring
ilevel: 880, stats: { +1519 Sta, +1484 Crit, +1114 Vers }, gems: { +150 Vers }, enchant: { +200 Mastery }
Local Finger2 Ring of Collapsing Futures
ilevel: 870, stats: { +1385 Sta, +1677 Mastery, +768 Haste, +419 Avoidance }, enchant: { +200 Vers }
Local Trinket1 Convergence of Fates
ilevel: 910, stats: { +2264 StrAgi }
Local Trinket2 Nightblooming Frond
ilevel: 910, stats: { +2264 Agi }
Local Back Drape of the Mana-Starved
ilevel: 875, stats: { 142 Armor, +1450 Sta, +967 StrAgiInt, +586 Crit, +259 Vers }, gems: { +200 Agi }, enchant: { +200 Agi }
Local Main Hand Fangs of the Devourer
ilevel: 906, weapon: { 3844 - 7140, 1.8 }, stats: { +983 Agi, +1475 Sta, +368 Crit, +353 Mastery }, relics: { +53 ilevels, +51 ilevels, +52 ilevels }
Local Off Hand Fangs of the Devourer
ilevel: 906, weapon: { 3844 - 7140, 1.8 }, stats: { +983 Agi, +1475 Sta, +368 Crit, +353 Mastery }

Talents

Level
15 Master of Subtlety (Subtlety Rogue) Weaponmaster (Subtlety Rogue) Gloomblade (Subtlety Rogue)
30 Nightstalker Subterfuge Shadow Focus
45 Deeper Stratagem Anticipation Vigor
60 Soothing Darkness (Subtlety Rogue) Elusiveness Cheat Death
75 Strike from the Shadows (Subtlety Rogue) Prey on the Weak Tangled Shadow (Subtlety Rogue)
90 Premeditation (Subtlety Rogue) Alacrity Enveloping Shadows (Subtlety Rogue)
100 Master of Shadows (Subtlety Rogue) Marked for Death Death from Above

Profile

rogue="CoF+NF"
origin="https://eu.api.battle.net/wow/character/dalaran/Esdeåth/advanced"
level=110
race=human
role=attack
position=back
professions=alchemy=800/enchanting=133
talents=1210011
artifact=17:0:0:0:0:851:1:852:3:853:3:854:3:855:3:856:3:857:3:858:3:859:3:860:3:861:1:862:1:863:1:864:1:865:1:866:1:1349:1:1386:14
spec=subtlety

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,name=flask_of_the_seventh_demon
actions.precombat+=/augmentation,name=defiled
actions.precombat+=/food,name=seedbattered_fish_plate
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/stealth
actions.precombat+=/potion,name=old_war
actions.precombat+=/marked_for_death,if=raid_event.adds.in>40
# Defined variables that doesn't change during the fight
actions.precombat+=/variable,name=ssw_refund,value=equipped.shadow_satyrs_walk*(4+ssw_refund_offset)
actions.precombat+=/variable,name=stealth_threshold,value=(15+talent.vigor.enabled*35+talent.master_of_shadows.enabled*30+variable.ssw_refund)
actions.precombat+=/enveloping_shadows,if=combo_points>=5
actions.precombat+=/symbols_of_death

# Executed every time the actor is available.
actions=call_action_list,name=cds
# Fully switch to the Stealthed Rotation (by doing so, it forces pooling if nothing is available)
actions+=/run_action_list,name=stealthed,if=stealthed.all
actions+=/call_action_list,name=finish,if=combo_points>=5|(combo_points>=4&spell_targets.shuriken_storm>=3&spell_targets.shuriken_storm<=4)
actions+=/call_action_list,name=stealth_als,if=combo_points.deficit>=2+talent.premeditation.enabled
actions+=/call_action_list,name=build,if=energy.deficit<=variable.stealth_threshold

# Builders
actions.build=shuriken_storm,if=spell_targets.shuriken_storm>=2
actions.build+=/gloomblade
actions.build+=/backstab

# Cooldowns
actions.cds=potion,name=old_war,if=buff.bloodlust.react|target.time_to_die<=25|buff.shadow_blades.up
actions.cds+=/use_item,slot=finger2,if=(buff.shadow_blades.up&stealthed.rogue)|target.time_to_die<20
actions.cds+=/blood_fury,if=stealthed.rogue
actions.cds+=/berserking,if=stealthed.rogue
actions.cds+=/arcane_torrent,if=stealthed.rogue&energy.deficit>70
actions.cds+=/shadow_blades,if=combo_points<=2|(equipped.denial_of_the_halfgiants&combo_points>=1)
actions.cds+=/goremaws_bite,if=!stealthed.all&cooldown.shadow_dance.charges_fractional<=2.45&((combo_points.deficit>=4-(time<10)*2&energy.deficit>50+talent.vigor.enabled*25-(time>=10)*15)|target.time_to_die<8)
actions.cds+=/marked_for_death,target_if=min:target.time_to_die,if=target.time_to_die<combo_points.deficit|(raid_event.adds.in>40&combo_points.deficit>=4+talent.deeper_strategem.enabled+talent.anticipation.enabled)

# Finishers
actions.finish=enveloping_shadows,if=buff.enveloping_shadows.remains<target.time_to_die&buff.enveloping_shadows.remains<=combo_points*1.8
actions.finish+=/death_from_above,if=spell_targets.death_from_above>=6
actions.finish+=/nightblade,cycle_targets=1,if=target.time_to_die>8&((refreshable&(!finality|buff.finality_nightblade.up))|remains<tick_time)
actions.finish+=/death_from_above
actions.finish+=/eviscerate

# Stealth Action List Starter
actions.stealth_als=call_action_list,name=stealth_cds,if=energy.deficit<=variable.stealth_threshold&(!equipped.shadow_satyrs_walk|cooldown.shadow_dance.charges_fractional>=2.45|energy.deficit>=10)
actions.stealth_als+=/call_action_list,name=stealth_cds,if=spell_targets.shuriken_storm>=5
actions.stealth_als+=/call_action_list,name=stealth_cds,if=(cooldown.shadowmeld.up&!cooldown.vanish.up&cooldown.shadow_dance.charges<=1)
actions.stealth_als+=/call_action_list,name=stealth_cds,if=target.time_to_die<12*cooldown.shadow_dance.charges_fractional*(1+equipped.shadow_satyrs_walk*0.5)

# Stealth Cooldowns
actions.stealth_cds=shadow_dance,if=charges_fractional>=2.45
actions.stealth_cds+=/vanish
actions.stealth_cds+=/sprint_offensive
actions.stealth_cds+=/shadow_dance,if=charges>=2&combo_points<=1
actions.stealth_cds+=/pool_resource,for_next=1,extra_amount=40
actions.stealth_cds+=/shadowmeld,if=energy>=40&energy.deficit>=10+variable.ssw_refund
actions.stealth_cds+=/shadow_dance,if=combo_points<=1

# Stealthed Rotation
actions.stealthed=symbols_of_death,if=(buff.symbols_of_death.remains<target.time_to_die-4&buff.symbols_of_death.remains<=buff.symbols_of_death.duration*0.3)|equipped.shadow_satyrs_walk&energy.time_to_max<0.25
actions.stealthed+=/call_action_list,name=finish,if=combo_points>=5
actions.stealthed+=/shuriken_storm,if=buff.shadowmeld.down&((combo_points.deficit>=3&spell_targets.shuriken_storm>=2+talent.premeditation.enabled+equipped.shadow_satyrs_walk)|buff.the_dreadlords_deceit.stack>=29)
actions.stealthed+=/shadowstrike

head=cowl_of_fright,id=139205,bonus_id=1805/43/1507/3337
neck=sea_fan_pendant,id=142428,bonus_id=3507/1497,enchant=mark_of_the_hidden_satyr
shoulders=steelgazer_hide_mantle,id=134154,bonus_id=3417/43/1542/3337
back=drape_of_the_manastarved,id=141543,bonus_id=1808/1487/3337,gems=200agi,enchant=200agi
chest=biornskin_vest,id=134197,bonus_id=3417/1552/3337
shirt=common_gray_shirt,id=3428
wrists=denial_of_the_halfgiants,id=137100,bonus_id=3459/3458
hands=cruel_vice_grips,id=133617,bonus_id=3510/1537/3337
waist=strand_of_whelk_shells,id=142416,bonus_id=3507/1808/1497,gems=150mastery
legs=legwraps_of_unworthy_souls,id=133616,bonus_id=3418/1532/3337
feet=shadow_satyrs_walk,id=137032,bonus_id=3459/3458
finger1=grubby_silver_ring,id=139236,bonus_id=1806/1808/1502,gems=150vers,enchant=200mastery
finger2=ring_of_collapsing_futures,id=142173,bonus_id=40/3453/1482/3336,enchant=200vers
trinket1=convergence_of_fates,id=140806,bonus_id=3519
trinket2=nightblooming_frond,id=140802,bonus_id=3519
main_hand=fangs_of_the_devourer,id=128476,bonus_id=743,gem_id=139267/142512/139253/0,relic_id=1806:1507:3336/3468:1492/1806:1502/0
off_hand=fangs_of_the_devourer,id=128479

# Gear Summary
# gear_ilvl=891.06
# gear_agility=20768
# gear_stamina=28183
# gear_crit_rating=5349
# gear_haste_rating=3511
# gear_mastery_rating=8343
# gear_versatility_rating=3832
# gear_avoidance_rating=419
# gear_armor=2297

EEF+DoS : 553906 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
553906.1 553906.1 602.3 / 0.109% 83824.9 / 15.1% 19202.1
RPS Out RPS In Primary Resource Waiting APM Active Skill
28.8 28.8 Energy 20.65% 56.9 100.0% 100%
Origin https://eu.api.battle.net/wow/character/dalaran/Esdeåth/advanced
Talents
  • 15: Master of Subtlety (Subtlety Rogue)
  • 30: Subterfuge
  • 45: Deeper Stratagem
  • 90: Premeditation (Subtlety Rogue)
  • 100: Master of Shadows (Subtlety Rogue)
  • Talent Calculator
Artifact
Professions
  • alchemy: 800
  • enchanting: 133

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
EEF+DoS 553906
auto_attack_mh 10468 1.9% 127.2 1.94sec 25001 16322 Direct 127.2 23648 47298 25001 24.7% 19.0%  

Stats details: auto_attack_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 127.24 127.24 0.00 0.00 1.5317 0.0000 3181039.07 4676428.74 31.98 16321.89 16321.89
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 71.69 56.34% 23648.36 18265 24110 23653.41 23049 24079 1695366 2492349 31.98
crit 31.41 24.69% 47297.83 36530 48220 47309.44 45384 48220 1485673 2184080 31.98
miss 24.14 18.97% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_mh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
auto_attack_oh 5192 0.9% 126.4 1.96sec 12487 8094 Direct 126.4 11822 23640 12487 24.6% 19.0%  

Stats details: auto_attack_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 126.35 126.35 0.00 0.00 1.5427 0.0000 1577748.66 2319439.97 31.98 8094.13 8094.13
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 71.22 56.37% 11822.31 9133 12055 11825.03 11542 12017 841981 1237791 31.98
crit 31.12 24.63% 23640.06 18265 24110 23645.85 22722 24110 735768 1081649 31.98
miss 24.01 19.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_oh

Static Values
  • id:1
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Backstab 28537 5.2% 53.2 5.36sec 162192 161469 Direct 53.2 130017 260063 162193 24.7% 0.0%  

Stats details: backstab

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 53.19 53.19 0.00 0.00 1.0045 0.0000 8626952.96 12682438.01 31.98 161468.76 161468.76
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 40.03 75.26% 130017.04 101005 133327 130051.48 125898 132923 5204523 7651141 31.98
crit 13.16 24.74% 260063.35 202010 266653 260156.49 242412 266653 3422430 5031297 31.98
 
 

Action details: backstab

Static Values
  • id:53
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:53
  • name:Backstab
  • school:physical
  • tooltip:
  • description:Stab the target, causing ${$sw2*$<mult>} Physical damage. Damage increased by {$s4=30}% when you are behind your target. |cFFFFFFFFAwards {$s3=1} combo $lpoint:points;.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.70
 
Collapse 1632 0.3% 5.9 43.93sec 82830 0 Direct 5.9 66480 132895 82829 24.6% 0.0%  

Stats details: collapse

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.87 5.87 0.00 0.00 0.0000 0.0000 485878.20 485878.20 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.42 75.38% 66479.80 50574 66758 66104.16 0 66758 293966 293966 0.00
crit 1.44 24.62% 132895.29 101148 133516 101009.25 0 133516 191912 191912 0.00
 
 

Action details: collapse

Static Values
  • id:234142
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:15.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:234142
  • name:Collapse
  • school:shadow
  • tooltip:
  • description:Deal {$s1=40000} Shadow damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:40000.00
  • base_dd_max:40000.00
 
Eviscerate 160696 29.0% 52.8 5.60sec 912680 908605 Direct 52.8 653103 1306677 912738 39.7% 0.0%  

Stats details: eviscerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 52.80 52.80 0.00 0.00 1.0045 0.0000 48190576.92 70844712.81 31.98 908604.72 908604.72
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 31.83 60.28% 653102.79 401033 935704 653409.75 598431 729545 20786758 30558503 31.98
crit 20.97 39.72% 1306676.69 802066 1871408 1307339.93 1158825 1494057 27403819 40286210 31.98
 
 

Action details: eviscerate

Static Values
  • id:196819
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.15
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:196819
  • name:Eviscerate
  • school:physical
  • tooltip:
  • description:Finishing move that disembowels the target, causing damage per combo point. 1 point : ${$m1*1} damage 2 points: ${$m1*2} damage 3 points: ${$m1*3} damage 4 points: ${$m1*4} damage 5 points: ${$m1*5} damage{$?s193531=false}[ 6 points: ${$m1*6} damage][]
Weapon
  • normalized:false
  • weapon_power_mod:0.000000
  • weapon_multiplier:0.00
 
Fel-Crazed Rage 36575 6.6% 35.8 8.13sec 306770 0 Direct 35.8 246975 493886 306853 24.2% 0.0%  

Stats details: felcrazed_rage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 35.83 35.82 0.00 0.00 0.0000 0.0000 10991611.05 10991611.05 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 27.13 75.75% 246974.69 188967 249436 247119.26 218285 249436 6701541 6701541 0.00
crit 8.69 24.25% 493885.53 377933 498872 493996.52 0 498872 4290070 4290070 0.00
 
 

Action details: felcrazed_rage

Static Values
  • id:225777
  • school:shadow
  • resource:none
  • range:8.0
  • travel_speed:30.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:225777
  • name:Fel-Crazed Rage
  • school:shadow
  • tooltip:
  • description:{$@spelldesc225141=Enter a fel-crazed rage, dealing {$225777s1=53264 to 58870} Shadow damage to a random nearby enemy every ${$t1}.2 sec for {$d=3 seconds}. You cannot move or use abilities during your rage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:141984.15
  • base_dd_max:156929.85
 
Goremaw's Bite 0 (9483) 0.0% (1.7%) 4.6 63.64sec 616376 613638

Stats details: goremaws_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.63 0.00 0.00 0.00 1.0045 0.0000 0.00 0.00 0.00 613638.09 613638.09
 
 

Action details: goremaws_bite

Static Values
  • id:209782
  • school:shadow
  • resource:none
  • range:8.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!stealthed.all&cooldown.shadow_dance.charges_fractional<=2.45&((combo_points.deficit>=4-(time<10)*2&energy.deficit>50+talent.vigor.enabled*25-(time>=10)*15)|target.time_to_die<8)
Spelldata
  • id:209782
  • name:Goremaw's Bite
  • school:physical
  • tooltip:
  • description:Lashes out at the target, inflicting ${$209783sw2+$209784sw2} Shadow damage and reducing movement speed by {$209786s1=60}% for {$209786d=8 seconds}. Grants $220901o2 Energy over {$220901d=6 seconds}. |cFFFFFFFFAwards {$220901s1=3} combo $lpoint:points;.|r
 
    Goremaw's Bite (_mh) 6325 1.1% 4.6 63.64sec 411131 0 Direct 4.6 329364 658806 411128 24.8% 0.0%  

Stats details: goremaws_bite_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.63 4.63 0.00 0.00 0.0000 0.0000 1904904.13 1904904.13 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 3.48 75.18% 329364.04 257468 339858 328428.98 0 339858 1147262 1147262 0.00
crit 1.15 24.82% 658806.02 514937 679717 479771.67 0 679717 757642 757642 0.00
 
 

Action details: goremaws_bite_mh

Static Values
  • id:209783
  • school:shadow
  • resource:none
  • range:8.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:209783
  • name:Goremaw's Bite
  • school:shadow
  • tooltip:
  • description:{$@spelldesc209782=Lashes out at the target, inflicting ${$209783sw2+$209784sw2} Shadow damage and reducing movement speed by {$209786s1=60}% for {$209786d=8 seconds}. Grants $220901o2 Energy over {$220901d=6 seconds}. |cFFFFFFFFAwards {$220901s1=3} combo $lpoint:points;.|r}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:10.00
 
    Goremaw's Bite (_oh) 3158 0.6% 4.6 63.64sec 205245 0 Direct 4.6 164694 329393 205230 24.6% 0.0%  

Stats details: goremaws_bite_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.63 4.63 0.00 0.00 0.0000 0.0000 950967.55 950967.55 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 3.49 75.38% 164694.35 128741 169938 164375.06 0 169938 575190 575190 0.00
crit 1.14 24.62% 329393.50 257481 339875 238490.47 0 339875 375777 375777 0.00
 
 

Action details: goremaws_bite_oh

Static Values
  • id:209784
  • school:shadow
  • resource:none
  • range:8.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:209784
  • name:Goremaw's Bite
  • school:shadow
  • tooltip:
  • description:{$@spelldesc209782=Lashes out at the target, inflicting ${$209783sw2+$209784sw2} Shadow damage and reducing movement speed by {$209786s1=60}% for {$209786d=8 seconds}. Grants $220901o2 Energy over {$220901d=6 seconds}. |cFFFFFFFFAwards {$220901s1=3} combo $lpoint:points;.|r}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:10.00
 
Mark of the Hidden Satyr 8466 1.5% 16.9 17.55sec 150912 0 Direct 16.9 121057 242118 150904 24.7% 0.0%  

Stats details: mark_of_the_hidden_satyr

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.88 16.88 0.00 0.00 0.0000 0.0000 2548054.22 2548054.22 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 12.72 75.34% 121057.12 93052 122828 121068.75 115384 122828 1539915 1539915 0.00
crit 4.16 24.66% 242118.14 186103 245656 238095.65 0 245656 1008139 1008139 0.00
 
 

Action details: mark_of_the_hidden_satyr

Static Values
  • id:191259
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191259
  • name:Mark of the Hidden Satyr
  • school:fire
  • tooltip:
  • description:Deals fire damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:2.500000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Nightblade 112129 20.3% 17.0 17.46sec 1992750 1983854 Periodic 143.3 189128 378135 235706 24.6% 0.0% 95.1%

Stats details: nightblade

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.95 0.00 143.31 143.31 1.0045 2.0000 33779089.17 33779089.17 0.00 111242.40 1983854.42
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 108.0 75.36% 189127.51 127142 247217 189163.53 182036 203288 20425065 20425065 0.00
crit 35.3 24.64% 378135.31 254285 494434 378227.13 346902 411170 13354024 13354024 0.00
 
 

Action details: nightblade

Static Values
  • id:195452
  • school:shadow
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:25.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:target.time_to_die>8&((refreshable&(!finality|buff.finality_nightblade.up))|remains<tick_time)
Spelldata
  • id:195452
  • name:Nightblade
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec and snared by attacks.
  • description:Finishing move that infects the target with shadowy energy, dealing Shadow damage over time and causing attacks against the target to reduce movement speed by {$206760s1=30}% for {$206760d=8 seconds}. Lasts longer per combo point. 1 point : ${$m1*8/2} over 8 sec 2 points: ${$m1*10/2} over 10 sec 3 points: ${$m1*12/2} over 12 sec 4 points: ${$m1*14/2} over 14 sec 5 points: ${$m1*16/2} over 16 sec{$?s193531=false}[ 6 points: ${$m1*18/2} over 18 sec][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:1.380000
  • spell_power_mod.tick:0.000000
  • base_td:1.00
  • dot_duration:6.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Potion of the Old War 17866 3.2% 22.2 9.49sec 237995 0 Direct 22.2 190915 381814 238007 24.7% 0.0%  

Stats details: potion_of_the_old_war

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.18 22.18 0.00 0.00 0.0000 0.0000 5278548.65 7759966.52 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.71 75.34% 190915.49 146122 192882 190917.22 179244 192882 3190068 4689702 31.98
crit 5.47 24.66% 381814.22 292245 385763 380715.89 0 385763 2088481 3070264 31.89
 
 

Action details: potion_of_the_old_war

Static Values
  • id:188028
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188028
  • name:Potion of the Old War
  • school:physical
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:135920.00
  • base_dd_max:203880.00
 
Shadow Blades 0 (14333) 0.0% (2.5%) 2.1 180.24sec 2023454 0

Stats details: shadow_blades

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.10 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: shadow_blades

Static Values
  • id:121471
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:combo_points<=2|(equipped.denial_of_the_halfgiants&combo_points>=1)
Spelldata
  • id:121471
  • name:Shadow Blades
  • school:physical
  • tooltip:Autoattacks deal pure Shadow damage. Combo-point-generating attacks generate {$s2=1} additional combo point.
  • description:Draws upon surrounding shadows to empower your weapons, causing auto attacks to deal Shadow damage and abilities that generate combo points to generate 1 additional combo point. Lasts {$d=15 seconds}.
 
    Shadow Blade (_mh) 9553 1.7% 64.5 3.65sec 43823 31630 Direct 64.5 35168 70315 43823 24.6% 0.0%  

Stats details: shadow_blade_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 64.51 64.51 0.00 0.00 1.3855 0.0000 2827000.15 2827000.15 0.00 31630.42 31630.42
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 48.62 75.37% 35168.03 26852 35444 35166.47 34460 35444 1709970 1709970 0.00
crit 15.89 24.63% 70315.37 53703 70888 70311.55 67666 70888 1117030 1117030 0.00
 
 

Action details: shadow_blade_mh

Static Values
  • id:121473
  • school:shadow
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:121473
  • name:Shadow Blade
  • school:shadow
  • tooltip:
  • description:Strike with dark energy, dealing Shadow damage equal to {$s1=1}% weapon damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
    Shadow Blade Off-hand 4780 0.9% 64.5 3.65sec 21929 15828 Direct 64.5 17584 35161 21930 24.7% 0.0%  

Stats details: shadow_blade_offhand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 64.51 64.51 0.00 0.00 1.3855 0.0000 1414602.60 1414602.60 0.00 15827.72 15827.72
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 48.56 75.28% 17583.52 13426 17722 17582.78 17191 17722 853854 853854 0.00
crit 15.95 24.72% 35160.73 26852 35444 35158.86 33887 35444 560749 560749 0.00
 
 

Action details: shadow_blade_offhand

Static Values
  • id:121474
  • school:shadow
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:121474
  • name:Shadow Blade Off-hand
  • school:shadow
  • tooltip:
  • description:Strike with dark energy, dealing Shadow damage equal to {$s1=1}% weapon damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Shadow Nova 10058 1.8% 31.7 9.51sec 95446 0 Direct 31.7 76641 153280 95448 24.5% 0.0%  

Stats details: shadow_nova

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 31.65 31.65 0.00 0.00 0.0000 0.0000 3021151.68 3021151.68 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 23.89 75.46% 76641.24 63871 76645 76641.34 75935 76645 1830697 1830697 0.00
crit 7.77 24.54% 153279.68 127741 153290 153280.02 146902 153290 1190455 1190455 0.00
 
 

Action details: shadow_nova

Static Values
  • id:197800
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:5.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:197800
  • name:Shadow Nova
  • school:shadow
  • tooltip:
  • description:Deals {$s1=0} Shadow damage to enemies with $A1 yards.
 
Shadowstrike 112828 (138470) 20.4% (25.0%) 102.2 2.90sec 406876 405055 Direct 102.2 246294 492594 331529 34.6% 0.0%  

Stats details: shadowstrike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 102.16 102.16 0.00 0.00 1.0045 0.0000 33869820.85 49791844.89 31.98 405055.17 405055.17
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 66.81 65.40% 246293.62 205255 246306 246293.38 244107 246306 16454916 24190286 31.98
crit 35.35 34.60% 492593.93 410510 492612 492594.92 488401 492612 17414905 25601559 31.98
 
 

Action details: shadowstrike

Static Values
  • id:185438
  • school:physical
  • resource:energy
  • range:15.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:185438
  • name:Shadowstrike
  • school:physical
  • tooltip:
  • description:Strike through the shadows, $?a231718[appearing behind your target and ][]dealing $sw2 Physical damage. |cFFFFFFFFAwards {$s3=1} combo $lpoint:points;.|r
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:8.50
 
    Soul Rip 25643 4.6% 101.6 2.90sec 75789 0 Direct 101.6 60831 121661 75792 24.6% 0.0%  

Stats details: soul_rip

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 101.57 101.57 0.00 0.00 0.0000 0.0000 7698156.18 7698156.18 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 76.60 75.41% 60830.51 60831 60831 60830.51 60831 60831 4659381 4659381 0.00
crit 24.98 24.59% 121661.02 121661 121661 121661.02 121661 121661 3038775 3038775 0.00
 
 

Action details: soul_rip

Static Values
  • id:220893
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:220893
  • name:Soul Rip
  • school:shadow
  • tooltip:
  • description:{$@spelldesc209835=After using Shadowstrike or Cheap Shot, Akaari's Soul appears $m1 sec later and Soul Rips your target, dealing {$220893s1=1} Shadow damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:1.500000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Simple Action Stats Execute Interval
EEF+DoS
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:EEF+DoS
  • harmful:false
  • if_expr:
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:EEF+DoS
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:EEF+DoS
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Shadow Dance 25.9 11.52sec

Stats details: shadow_dance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 25.95 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: shadow_dance

Static Values
  • id:185313
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:charges_fractional>=2.45
Spelldata
  • id:185313
  • name:Shadow Dance
  • school:physical
  • tooltip:
  • description:Allows use of all Stealth abilities and grants all the combat benefits of Stealth for {$d=3 seconds}. Effect not broken from taking damage or attacking. {$?s14062=false}[Movement speed while active is increased by {$1784s3=0}% and damage dealt is increased by {$1784s4=0}%. ]?s108209[Abilities cost {$112942s1=75}% less while active. ][]{$?s31223=false}[Attacks from Shadow Dance and for {$31223s1=5} sec after deal {$31665s1=10}% more damage. ][]
 
Sprint 2.7 122.30sec

Stats details: sprint

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.71 0.00 85.73 0.00 0.0000 0.2500 0.00 0.00 0.00 0.00 0.00
 
 

Action details: sprint

Static Values
  • id:2983
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:2983
  • name:Sprint
  • school:physical
  • tooltip:Movement speed increased by $w1%.
  • description:Increases your movement speed by {$s1=70}% for {$d=8 seconds}. Usable while stealthed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:0.25
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Symbols of Death 13.7 23.26sec

Stats details: symbols_of_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.65 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: symbols_of_death

Static Values
  • id:212283
  • school:physical
  • resource:energy
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:10.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:212283
  • name:Symbols of Death
  • school:physical
  • tooltip:All damage done increased by {$s1=20}%.
  • description:Invoke ancient symbols of power, increasing all damage you deal by {$s1=20}% for {$d=35 seconds}, and causing your next Shadowstrike to critically strike. Unaffected by the global cooldown.
 
Vanish 2.8 122.21sec

Stats details: vanish

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.81 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: vanish

Static Values
  • id:1856
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:1856
  • name:Vanish
  • school:physical
  • tooltip:Improved stealth.
  • description:Allows you to vanish from sight, entering stealth while in combat. For the first {$11327d=3 seconds} after vanishing, damage and harmful effects received will not break stealth. Also breaks movement impairing effects.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Arcane Enchant 1.2 0.1 106.6sec 91.3sec 7.90% 7.90% 0.1(0.1) 1.1

Buff details

  • buff initial source:EEF+DoS
  • cooldown name:buff_arcane_enchant
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:4828.95

Stack Uptimes

  • arcane_enchant_1:7.90%

Trigger Attempt Success

  • trigger_pct:73.97%

Spelldata details

  • id:225730
  • name:Arcane Enchant
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc225129=Your melee and ranged attacks have a chance to grant you a Fiery, Frost, or Arcane enchant for {$225726d=20 seconds}. }
  • max_stacks:0
  • duration:20.00
  • cooldown:1.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 24.14% 0.0(0.0) 1.0

Buff details

  • buff initial source:EEF+DoS
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Death 13.7 0.0 22.3sec 23.2sec 2.36% 13.20% 0.0(0.0) 0.2

Buff details

  • buff initial source:EEF+DoS
  • cooldown name:buff_death
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • death_1:2.36%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:227151
  • name:Death
  • tooltip:Your next Shadowstrike will critically strike.
  • description:{$@spelldesc212283=Invoke ancient symbols of power, increasing all damage you deal by {$s1=20}% for {$d=35 seconds}, and causing your next Shadowstrike to critically strike. Unaffected by the global cooldown.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Faster Than Light Trigger 2.7 0.0 122.2sec 122.2sec 2.69% 2.69% 0.0(0.0) 2.7

Buff details

  • buff initial source:EEF+DoS
  • cooldown name:buff_faster_than_light_trigger
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • faster_than_light_trigger_1:2.69%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:197270
  • name:Faster Than Light Trigger
  • tooltip:
  • description:
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
Fiery Enchant 1.2 0.1 103.2sec 87.3sec 7.93% 7.93% 0.1(0.1) 1.1

Buff details

  • buff initial source:EEF+DoS
  • cooldown name:buff_fiery_enchant
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:4828.95

Stack Uptimes

  • fiery_enchant_1:7.93%

Trigger Attempt Success

  • trigger_pct:73.01%

Spelldata details

  • id:225726
  • name:Fiery Enchant
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc225129=Your melee and ranged attacks have a chance to grant you a Fiery, Frost, or Arcane enchant for {$225726d=20 seconds}. }
  • max_stacks:0
  • duration:20.00
  • cooldown:1.00
  • default_chance:0.00%
Finality: Eviscerate 26.7 0.0 11.2sec 11.2sec 48.27% 49.52% 0.0(0.0) 0.0

Buff details

  • buff initial source:EEF+DoS
  • cooldown name:buff_finality_eviscerate
  • max_stacks:10
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.04

Stack Uptimes

  • finality_eviscerate_5:23.23%
  • finality_eviscerate_6:25.04%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:197496
  • name:Finality: Eviscerate
  • tooltip:Your next Eviscerate will do $w1% increased damage.
  • description:
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Finality: Nightblade 8.7 0.0 35.1sec 35.1sec 42.87% 40.97% 0.0(0.0) 0.0

Buff details

  • buff initial source:EEF+DoS
  • cooldown name:buff_finality_nightblade
  • max_stacks:6
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.04

Stack Uptimes

  • finality_nightblade_5:17.48%
  • finality_nightblade_6:25.39%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:197498
  • name:Finality: Nightblade
  • tooltip:Your next Nightblade will do $w1% increased damage.
  • description:
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Frost Enchant 1.2 0.1 103.2sec 87.0sec 8.00% 8.00% 0.1(0.1) 1.1

Buff details

  • buff initial source:EEF+DoS
  • cooldown name:buff_frost_enchant
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:4828.95

Stack Uptimes

  • frost_enchant_1:8.00%

Trigger Attempt Success

  • trigger_pct:74.31%

Spelldata details

  • id:225729
  • name:Frost Enchant
  • tooltip:Mastery increased by $w1.
  • description:{$@spelldesc225129=Your melee and ranged attacks have a chance to grant you a Fiery, Frost, or Arcane enchant for {$225726d=20 seconds}. }
  • max_stacks:0
  • duration:20.00
  • cooldown:1.00
  • default_chance:0.00%
Goremaw's Bite 4.6 0.0 63.6sec 63.6sec 9.12% 9.12% 27.4(27.4) 4.5

Buff details

  • buff initial source:EEF+DoS
  • cooldown name:buff_goremaws_bite
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • goremaws_bite_1:9.12%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:220901
  • name:Goremaw's Bite
  • tooltip:Generating {$s2=5} Energy every $t2 sec.
  • description:{$@spelldesc209782=Lashes out at the target, inflicting ${$209783sw2+$209784sw2} Shadow damage and reducing movement speed by {$209786s1=60}% for {$209786d=8 seconds}. Grants $220901o2 Energy over {$220901d=6 seconds}. |cFFFFFFFFAwards {$220901s1=3} combo $lpoint:points;.|r}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Master of Subtlety 36.5 1.4 8.2sec 7.9sec 34.45% 47.18% 1.4(1.4) 12.7

Buff details

  • buff initial source:EEF+DoS
  • cooldown name:buff_master_of_subtlety
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • master_of_subtlety_1:34.45%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:31223
  • name:Master of Subtlety
  • tooltip:
  • description:Attacks made while stealthed and for {$s1=5} seconds after breaking stealth cause an additional {$31665s1=10}% damage.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Master of Subtlety (_aura) 36.5 1.4 8.3sec 8.0sec 48.88% 34.74% 1.4(1.4) 0.0

Buff details

  • buff initial source:EEF+DoS
  • cooldown name:buff_master_of_subtlety_aura
  • max_stacks:1
  • duration:150.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • master_of_subtlety_aura_1:48.88%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:31223
  • name:Master of Subtlety
  • tooltip:
  • description:Attacks made while stealthed and for {$s1=5} seconds after breaking stealth cause an additional {$31665s1=10}% damage.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of the Old War 2.0 0.0 179.9sec 0.0sec 16.24% 16.24% 0.0(0.0) 2.0

Buff details

  • buff initial source:EEF+DoS
  • cooldown name:buff_potion_of_the_old_war
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_the_old_war_1:16.24%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188028
  • name:Potion of the Old War
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Shadow Blades 2.1 0.0 180.2sec 180.2sec 33.09% 36.68% 0.0(0.0) 2.0

Buff details

  • buff initial source:EEF+DoS
  • cooldown name:buff_shadow_blades
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • shadow_blades_1:33.09%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:121471
  • name:Shadow Blades
  • tooltip:Autoattacks deal pure Shadow damage. Combo-point-generating attacks generate {$s2=1} additional combo point.
  • description:Draws upon surrounding shadows to empower your weapons, causing auto attacks to deal Shadow damage and abilities that generate combo points to generate 1 additional combo point. Lasts {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Shadow Dance 25.9 0.0 11.5sec 11.5sec 42.91% 42.91% 0.0(0.0) 25.6

Buff details

  • buff initial source:EEF+DoS
  • cooldown name:buff_shadow_dance
  • max_stacks:1
  • duration:5.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • shadow_dance_1:42.91%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:185313
  • name:Shadow Dance
  • tooltip:
  • description:Allows use of all Stealth abilities and grants all the combat benefits of Stealth for {$d=3 seconds}. Effect not broken from taking damage or attacking. {$?s14062=false}[Movement speed while active is increased by {$1784s3=0}% and damage dealt is increased by {$1784s4=0}%. ]?s108209[Abilities cost {$112942s1=75}% less while active. ][]{$?s31223=false}[Attacks from Shadow Dance and for {$31223s1=5} sec after deal {$31665s1=10}% more damage. ][]
  • max_stacks:0
  • duration:3.00
  • cooldown:1.00
  • default_chance:0.00%
Sprint 2.7 0.0 122.2sec 122.2sec 7.11% 7.11% 85.7(85.7) 2.7

Buff details

  • buff initial source:EEF+DoS
  • cooldown name:buff_sprint
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • sprint_1:7.11%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2983
  • name:Sprint
  • tooltip:Movement speed increased by $w1%.
  • description:Increases your movement speed by {$s1=70}% for {$d=8 seconds}. Usable while stealthed.
  • max_stacks:0
  • duration:8.00
  • cooldown:120.00
  • default_chance:0.00%
Stealth 6.4 0.0 45.4sec 51.8sec 2.04% 2.04% 0.0(0.0) 0.0

Buff details

  • buff initial source:EEF+DoS
  • cooldown name:buff_stealth
  • max_stacks:1
  • duration:150.00
  • cooldown:2.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stealth_1:2.04%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:1784
  • name:Stealth
  • tooltip:Stealthed.$?$w3!=0[ Movement speed increased by $w3%.][]$?$w4!=0[ Damage increased by $w4%.][]
  • description:Conceals you in the shadows until cancelled, allowing you to stalk enemies without being seen. {$?s14062=false}[Movement speed while stealthed is increased by {$s3=0}% and damage dealt is increased by {$s4=0}%.]?s108209[ Abilities cost {$112942s1=75}% less while stealthed. ][]{$?s31223=false}[ Attacks from Stealth and for {$31223s1=5} sec after deal {$31665s1=10}% more damage.][]
  • max_stacks:0
  • duration:-0.00
  • cooldown:2.00
  • default_chance:100.00%
Subterfuge 6.5 0.0 44.5sec 44.5sec 6.47% 6.47% 0.0(0.0) 6.4

Buff details

  • buff initial source:EEF+DoS
  • cooldown name:buff_subterfuge
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • subterfuge_1:6.47%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:115192
  • name:Subterfuge
  • tooltip:Temporarily concealed in the shadows.
  • description:{$@spelldesc108208=Your abilities requiring Stealth can still be used for {$115192d=3 seconds} after Stealth breaks.$?c3[ Also increases the duration of Shadow Dance by ${$m2/1000} sec.][ Also causes Garrote to deal {$115192s2=125}% increased damage and have no cooldown when used from Stealth or {$115192d=3 seconds} after Stealth breaks.]}
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
Symbols of Death 1.2 12.5 196.2sec 23.2sec 99.80% 99.27% 12.5(12.5) 0.2

Buff details

  • buff initial source:EEF+DoS
  • cooldown name:buff_symbols_of_death
  • max_stacks:1
  • duration:35.00
  • cooldown:10.00
  • default_chance:100.00%
  • default_value:1.20

Stack Uptimes

  • symbols_of_death_1:99.80%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:212283
  • name:Symbols of Death
  • tooltip:All damage done increased by {$s1=20}%.
  • description:Invoke ancient symbols of power, increasing all damage you deal by {$s1=20}% for {$d=35 seconds}, and causing your next Shadowstrike to critically strike. Unaffected by the global cooldown.
  • max_stacks:0
  • duration:35.00
  • cooldown:10.00
  • default_chance:0.00%
Temptation 1.9 4.0 175.7sec 44.2sec 36.97% 66.54% 0.0(0.0) 1.4

Buff details

  • buff initial source:EEF+DoS
  • cooldown name:buff_temptation
  • max_stacks:10
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • temptation_1:9.83%
  • temptation_2:10.01%
  • temptation_3:9.69%
  • temptation_4:7.34%
  • temptation_5:0.13%
  • temptation_6:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:234143
  • name:Temptation
  • tooltip:Increased chance for your Ring of Collapsing Futures to incur a {$s1=5} min cooldown.
  • description:{$@spelldesc234142=Deal {$s1=40000} Shadow damage to an enemy.}
  • max_stacks:10
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Vanish 5.5 0.0 51.8sec 51.8sec 5.45% 5.45% 0.0(0.0) 5.4

Buff details

  • buff initial source:EEF+DoS
  • cooldown name:buff_vanish
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • vanish_1:5.45%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:11327
  • name:Vanish
  • tooltip:Improved stealth.$?$w3!=0[ Movement speed increased by $w3%.][]$?$w4!=0[ Damage increased by $w4%.][]
  • description:
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:EEF+DoS
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Seventh Demon

Buff details

  • buff initial source:EEF+DoS
  • cooldown name:buff_flask_of_the_seventh_demon
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:1300.00

Stack Uptimes

  • flask_of_the_seventh_demon_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188033
  • name:Flask of the Seventh Demon
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (seedbattered_fish_plate)

Buff details

  • buff initial source:EEF+DoS
  • cooldown name:buff_seedbattered_fish_plate
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:versatility_rating
  • amount:375.00

Stack Uptimes

  • seedbattered_fish_plate_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225605
  • name:Well Fed
  • tooltip:Versatility increased by $w1.
  • description:Increases versatility by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
EEF+DoS
backstab Energy 53.2 1861.6 35.0 35.0 4634.2
eviscerate Energy 52.8 1848.0 35.0 35.0 26077.4
eviscerate Combo Points 52.8 293.1 5.6 5.6 164444.0
nightblade Energy 17.0 423.8 25.0 25.0 79710.8
nightblade Combo Points 17.0 94.2 5.6 5.6 358757.0
shadowstrike Energy 102.2 4086.5 40.0 40.0 10172.0
symbols_of_death Energy 13.7 442.9 32.4 32.4 0.0
Resource Gains Type Count Total Average Overflow
backstab Combo Points 53.19 53.19 (13.64%) 1.00 0.00 0.00%
goremaws_bite Combo Points 4.63 13.74 (3.52%) 2.97 0.16 1.13%
shadowstrike Combo Points 102.16 204.33 (52.38%) 2.00 0.00 0.00%
energy_regen Energy 1160.70 3404.98 (39.57%) 2.93 160.49 4.50%
Shadow Techniques Combo Points 73.94 73.93 (18.95%) 1.00 14.81 16.69%
Master of Shadows Energy 36.91 770.69 (8.96%) 20.88 152.00 16.47%
Shadow Blades Combo Points 53.84 44.87 (11.50%) 0.83 8.97 16.66%
Energetic Stabbing Energy 25.51 637.77 (7.41%) 25.00 0.00 0.00%
Goremaw's Bite Energy 27.42 131.59 (1.53%) 4.80 5.50 4.01%
Relentless Strikes Energy 69.75 3046.04 (35.40%) 43.67 52.97 1.71%
Shadow Satyr's Walk Energy 102.16 612.98 (7.12%) 6.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Energy 28.56 28.75
Combo Points 1.29 1.29
Combat End Resource Mean Min Max
Energy 41.28 6.18 100.00
Combo Points 2.89 0.00 6.00

Benefits & Uptimes

Benefits %
Uptimes %
Energy Cap 3.0%

Statistics & Data Analysis

Fight Length
Sample Data EEF+DoS Fight Length
Count 4999
Mean 301.28
Minimum 222.03
Maximum 381.32
Spread ( max - min ) 159.29
Range [ ( max - min ) / 2 * 100% ] 26.44%
DPS
Sample Data EEF+DoS Damage Per Second
Count 4999
Mean 553906.12
Minimum 481403.78
Maximum 654322.44
Spread ( max - min ) 172918.66
Range [ ( max - min ) / 2 * 100% ] 15.61%
Standard Deviation 21728.9992
5th Percentile 518820.60
95th Percentile 589683.68
( 95th Percentile - 5th Percentile ) 70863.08
Mean Distribution
Standard Deviation 307.3252
95.00% Confidence Intervall ( 553303.78 - 554508.47 )
Normalized 95.00% Confidence Intervall ( 99.89% - 100.11% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 60
0.1% Error 5912
0.1 Scale Factor Error with Delta=300 4030539
0.05 Scale Factor Error with Delta=300 16122156
0.01 Scale Factor Error with Delta=300 403053891
Priority Target DPS
Sample Data EEF+DoS Priority Target Damage Per Second
Count 4999
Mean 553906.12
Minimum 481403.78
Maximum 654322.44
Spread ( max - min ) 172918.66
Range [ ( max - min ) / 2 * 100% ] 15.61%
Standard Deviation 21728.9992
5th Percentile 518820.60
95th Percentile 589683.68
( 95th Percentile - 5th Percentile ) 70863.08
Mean Distribution
Standard Deviation 307.3252
95.00% Confidence Intervall ( 553303.78 - 554508.47 )
Normalized 95.00% Confidence Intervall ( 99.89% - 100.11% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 60
0.1% Error 5912
0.1 Scale Factor Error with Delta=300 4030539
0.05 Scale Factor Error with Delta=300 16122156
0.01 Scale Factor Error with Delta=300 403053891
DPS(e)
Sample Data EEF+DoS Damage Per Second (Effective)
Count 4999
Mean 553906.12
Minimum 481403.78
Maximum 654322.44
Spread ( max - min ) 172918.66
Range [ ( max - min ) / 2 * 100% ] 15.61%
Damage
Sample Data EEF+DoS Damage
Count 4999
Mean 166346102.02
Minimum 121865746.95
Maximum 213449615.35
Spread ( max - min ) 91583868.40
Range [ ( max - min ) / 2 * 100% ] 27.53%
DTPS
Sample Data EEF+DoS Damage Taken Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data EEF+DoS Healing Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data EEF+DoS Healing Per Second (Effective)
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data EEF+DoS Heal
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data EEF+DoS Healing Taken Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data EEF+DoS Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data EEF+DoSTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data EEF+DoS Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,name=flask_of_the_seventh_demon
1 0.00 augmentation,name=defiled
2 0.00 food,name=seedbattered_fish_plate
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 stealth
5 0.00 potion,name=old_war
6 0.00 marked_for_death,if=raid_event.adds.in>40
7 0.00 variable,name=ssw_refund,value=equipped.shadow_satyrs_walk*(4+ssw_refund_offset)
Defined variables that doesn't change during the fight
8 0.00 variable,name=stealth_threshold,value=(15+talent.vigor.enabled*35+talent.master_of_shadows.enabled*30+variable.ssw_refund)
9 0.00 enveloping_shadows,if=combo_points>=5
A 0.00 symbols_of_death
Default action list Executed every time the actor is available.
# count action,conditions
B 0.00 call_action_list,name=cds
C 0.00 run_action_list,name=stealthed,if=stealthed.all
Fully switch to the Stealthed Rotation (by doing so, it forces pooling if nothing is available)
D 0.00 call_action_list,name=finish,if=combo_points>=5|(combo_points>=4&spell_targets.shuriken_storm>=3&spell_targets.shuriken_storm<=4)
E 0.00 call_action_list,name=stealth_als,if=combo_points.deficit>=2+talent.premeditation.enabled
F 0.00 call_action_list,name=build,if=energy.deficit<=variable.stealth_threshold
actions.build Builders
# count action,conditions
0.00 shuriken_storm,if=spell_targets.shuriken_storm>=2
0.00 gloomblade
G 53.19 backstab
actions.cds Cooldowns
# count action,conditions
H 1.00 potion,name=old_war,if=buff.bloodlust.react|target.time_to_die<=25|buff.shadow_blades.up
I 5.87 use_item,slot=finger2,if=(buff.shadow_blades.up&stealthed.rogue)|target.time_to_die<20
J 2.77 use_item,slot=trinket2,if=(buff.shadow_blades.up&stealthed.rogue)|target.time_to_die<20
0.00 blood_fury,if=stealthed.rogue
0.00 berserking,if=stealthed.rogue
0.00 arcane_torrent,if=stealthed.rogue&energy.deficit>70
K 2.10 shadow_blades,if=combo_points<=2|(equipped.denial_of_the_halfgiants&combo_points>=1)
L 4.63 goremaws_bite,if=!stealthed.all&cooldown.shadow_dance.charges_fractional<=2.45&((combo_points.deficit>=4-(time<10)*2&energy.deficit>50+talent.vigor.enabled*25-(time>=10)*15)|target.time_to_die<8)
0.00 marked_for_death,target_if=min:target.time_to_die,if=target.time_to_die<combo_points.deficit|(raid_event.adds.in>40&combo_points.deficit>=4+talent.deeper_strategem.enabled+talent.anticipation.enabled)
actions.finish Finishers
# count action,conditions
0.00 enveloping_shadows,if=buff.enveloping_shadows.remains<target.time_to_die&buff.enveloping_shadows.remains<=combo_points*1.8
0.00 death_from_above,if=spell_targets.death_from_above>=6
M 16.95 nightblade,cycle_targets=1,if=target.time_to_die>8&((refreshable&(!finality|buff.finality_nightblade.up))|remains<tick_time)
0.00 death_from_above
N 52.80 eviscerate
actions.stealth_cds Stealth Cooldowns
# count action,conditions
S 3.83 shadow_dance,if=charges_fractional>=2.45
T 2.81 vanish
U 2.71 sprint_offensive
V 4.23 shadow_dance,if=charges>=2&combo_points<=1
0.00 pool_resource,for_next=1,extra_amount=40
0.00 shadowmeld,if=energy>=40&energy.deficit>=10+variable.ssw_refund
W 17.89 shadow_dance,if=combo_points<=1
actions.stealthed Stealthed Rotation
# count action,conditions
X 12.65 symbols_of_death,if=(buff.symbols_of_death.remains<target.time_to_die-4&buff.symbols_of_death.remains<=buff.symbols_of_death.duration*0.3)|equipped.shadow_satyrs_walk&energy.time_to_max<0.25
Y 0.00 call_action_list,name=finish,if=combo_points>=5
0.00 shuriken_storm,if=buff.shadowmeld.down&((combo_points.deficit>=3&spell_targets.shuriken_storm>=2+talent.premeditation.enabled+equipped.shadow_satyrs_walk)|buff.the_dreadlords_deceit.stack>=29)
Z 102.16 shadowstrike

Sample Sequence

0124578AKIJZZMSZZNZZNGTXZNIZNSZZMZZNUVXZZNZZNGGNVIZZNZZNLMGGNSXZNZZINVZZMZZNGGGNVZZNZGGNVZZZMZGGNVXZZNGGMWZZZNLGGNWZZZMXZGGNWZZNZZNGGGMWZZZNXZTZNZGGGMUGGZNZGNVXZZZMZGNLGNVZZNZZGNWZZNZZMWXZKHJZNGGNWZZMXZZNGGNGNWXZZNZNWZZMZZNGGNLGNGGGMGGNVZZNZXGGMWZZNZZGNTZZZNVXZZMZZNUWZZZNZZJNWXZZNZLNWZZZNZGG

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask EEF+DoS 100.0/100: 100% energy | 0.0/6: 0% combo_points
Pre precombat 1 augmentation EEF+DoS 100.0/100: 100% energy | 0.0/6: 0% combo_points
Pre precombat 2 food EEF+DoS 100.0/100: 100% energy | 0.0/6: 0% combo_points
Pre precombat 4 stealth Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, stealth
Pre precombat 5 potion Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, stealth, potion_of_the_old_war
Pre precombat 7 ssw_refund Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, stealth, potion_of_the_old_war
Pre precombat 8 stealth_threshold Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, stealth, potion_of_the_old_war
Pre precombat A symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, stealth, symbols_of_death, death, potion_of_the_old_war
0:00.000 cds K shadow_blades Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, stealth, symbols_of_death, death, potion_of_the_old_war
0:00.000 cds I use_item_ring_of_collapsing_futures Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, stealth, symbols_of_death, shadow_blades, death, potion_of_the_old_war
0:00.000 cds J use_item_draught_of_souls Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points temptation, master_of_subtlety_aura, stealth, symbols_of_death, shadow_blades, death, potion_of_the_old_war
0:03.000 stealthed Z shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points bloodlust, temptation, master_of_subtlety_aura, stealth, symbols_of_death, shadow_blades, death, potion_of_the_old_war
0:04.004 stealthed Z shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 3.0/6: 50% combo_points bloodlust, temptation, master_of_subtlety_aura, stealth, subterfuge, symbols_of_death, shadow_blades, potion_of_the_old_war
0:05.006 finish M nightblade Fluffy_Pillow 80.7/100: 81% energy | 6.0/6: 100% combo_points bloodlust, temptation, master_of_subtlety_aura, stealth, subterfuge, symbols_of_death, shadow_blades, potion_of_the_old_war
0:06.011 stealth_cds S shadow_dance Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points bloodlust, temptation, master_of_subtlety, symbols_of_death, shadow_blades, finality_nightblade(6), potion_of_the_old_war
0:06.011 stealthed Z shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points bloodlust, temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6), potion_of_the_old_war
0:07.016 stealthed Z shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 4.0/6: 67% combo_points bloodlust, temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6), potion_of_the_old_war
0:08.020 finish N eviscerate Fluffy_Pillow 100.0/100: 100% energy | 6.0/6: 100% combo_points bloodlust, temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6), potion_of_the_old_war
0:09.025 stealthed Z shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points bloodlust, temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6), potion_of_the_old_war
0:10.030 stealthed Z shadowstrike Fluffy_Pillow 80.7/100: 81% energy | 3.0/6: 50% combo_points bloodlust, temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6), potion_of_the_old_war
0:11.034 finish N eviscerate Fluffy_Pillow 61.5/100: 61% energy | 6.0/6: 100% combo_points bloodlust, temptation, master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6), potion_of_the_old_war
0:12.039 build G backstab Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points bloodlust, temptation, master_of_subtlety, symbols_of_death, shadow_blades, finality_nightblade(6), potion_of_the_old_war
0:13.042 stealth_cds T vanish Fluffy_Pillow 79.7/100: 80% energy | 2.0/6: 33% combo_points bloodlust, temptation, master_of_subtlety, symbols_of_death, shadow_blades, finality_nightblade(6), potion_of_the_old_war
0:13.042 stealthed X symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 2.0/6: 33% combo_points bloodlust, temptation, master_of_subtlety_aura, vanish, symbols_of_death, shadow_blades, finality_nightblade(6), potion_of_the_old_war
0:13.042 stealthed Z shadowstrike Fluffy_Pillow 65.0/100: 65% energy | 2.0/6: 33% combo_points bloodlust, temptation, master_of_subtlety_aura, vanish, symbols_of_death, shadow_blades, death, finality_nightblade(6), potion_of_the_old_war
0:14.046 finish N eviscerate Fluffy_Pillow 45.7/100: 46% energy | 5.0/6: 83% combo_points bloodlust, temptation, master_of_subtlety_aura, vanish, subterfuge, symbols_of_death, shadow_blades, finality_nightblade(6), potion_of_the_old_war
0:15.052 cds I use_item_ring_of_collapsing_futures Fluffy_Pillow 65.5/100: 65% energy | 2.0/6: 33% combo_points bloodlust, temptation, master_of_subtlety_aura, vanish, subterfuge, symbols_of_death, shadow_blades, finality_eviscerate(5), finality_nightblade(6), potion_of_the_old_war
0:15.052 stealthed Z shadowstrike Fluffy_Pillow 65.5/100: 65% energy | 2.0/6: 33% combo_points bloodlust, temptation(2), master_of_subtlety_aura, vanish, subterfuge, symbols_of_death, shadow_blades, finality_eviscerate(5), finality_nightblade(6), potion_of_the_old_war
0:16.057 finish N eviscerate Fluffy_Pillow 71.2/100: 71% energy | 5.0/6: 83% combo_points bloodlust, temptation(2), master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(5), finality_nightblade(6), potion_of_the_old_war
0:17.061 stealth_cds S shadow_dance Fluffy_Pillow 91.0/100: 91% energy | 1.0/6: 17% combo_points bloodlust, temptation(2), master_of_subtlety, symbols_of_death, shadow_blades, finality_nightblade(6), potion_of_the_old_war
0:17.061 stealthed Z shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points bloodlust, temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6), potion_of_the_old_war
0:18.066 stealthed Z shadowstrike Fluffy_Pillow 80.7/100: 81% energy | 4.0/6: 67% combo_points bloodlust, temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6), potion_of_the_old_war
0:19.070 finish M nightblade Fluffy_Pillow 86.5/100: 86% energy | 6.0/6: 100% combo_points bloodlust, temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6), potion_of_the_old_war
0:20.075 stealthed Z shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points bloodlust, temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, potion_of_the_old_war
0:21.080 stealthed Z shadowstrike Fluffy_Pillow 80.7/100: 81% energy | 4.0/6: 67% combo_points bloodlust, temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, potion_of_the_old_war
0:22.084 finish N eviscerate Fluffy_Pillow 61.5/100: 61% energy | 6.0/6: 100% combo_points bloodlust, temptation(2), master_of_subtlety, symbols_of_death, shadow_blades, potion_of_the_old_war
0:23.088 stealth_cds U sprint Fluffy_Pillow 81.2/100: 81% energy | 1.0/6: 17% combo_points bloodlust, temptation(2), master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6)
0:23.088 stealth_cds V shadow_dance Fluffy_Pillow 81.2/100: 81% energy | 1.0/6: 17% combo_points bloodlust, temptation(2), master_of_subtlety, sprint, symbols_of_death, shadow_blades, finality_eviscerate(6), faster_than_light_trigger
0:23.088 stealthed X symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points bloodlust, temptation(2), master_of_subtlety_aura, shadow_dance, sprint, symbols_of_death, shadow_blades, finality_eviscerate(6), faster_than_light_trigger
0:23.088 stealthed Z shadowstrike Fluffy_Pillow 65.0/100: 65% energy | 1.0/6: 17% combo_points bloodlust, temptation(2), master_of_subtlety_aura, shadow_dance, sprint, symbols_of_death, shadow_blades, death, finality_eviscerate(6), faster_than_light_trigger
0:24.093 stealthed Z shadowstrike Fluffy_Pillow 70.7/100: 71% energy | 4.0/6: 67% combo_points bloodlust, temptation(2), master_of_subtlety_aura, shadow_dance, sprint, symbols_of_death, shadow_blades, finality_eviscerate(6), faster_than_light_trigger
0:25.097 finish N eviscerate Fluffy_Pillow 51.5/100: 51% energy | 6.0/6: 100% combo_points bloodlust, temptation(2), master_of_subtlety_aura, shadow_dance, sprint, symbols_of_death, shadow_blades, finality_eviscerate(6), faster_than_light_trigger
0:26.102 stealthed Z shadowstrike Fluffy_Pillow 96.2/100: 96% energy | 0.0/6: 0% combo_points bloodlust, temptation(2), master_of_subtlety_aura, shadow_dance, vanish, subterfuge, sprint, symbols_of_death, shadow_blades
0:27.105 stealthed Z shadowstrike Fluffy_Pillow 76.9/100: 77% energy | 3.0/6: 50% combo_points bloodlust, temptation(2), master_of_subtlety_aura, shadow_dance, vanish, subterfuge, sprint, symbols_of_death, shadow_blades
0:28.110 finish N eviscerate Fluffy_Pillow 57.7/100: 58% energy | 6.0/6: 100% combo_points bloodlust, temptation(2), master_of_subtlety, vanish, subterfuge, sprint, symbols_of_death, shadow_blades
0:29.117 build G backstab Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points bloodlust, temptation(2), master_of_subtlety, sprint, symbols_of_death, shadow_blades, finality_eviscerate(6)
0:30.120 build G backstab Fluffy_Pillow 79.7/100: 80% energy | 3.0/6: 50% combo_points bloodlust, temptation(2), master_of_subtlety, sprint, symbols_of_death, shadow_blades, finality_eviscerate(6)
0:31.123 finish N eviscerate Fluffy_Pillow 59.4/100: 59% energy | 5.0/6: 83% combo_points bloodlust, temptation(2), master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6)
0:32.128 stealth_cds V shadow_dance Fluffy_Pillow 79.2/100: 79% energy | 0.0/6: 0% combo_points bloodlust, temptation(2), master_of_subtlety, symbols_of_death, shadow_blades
0:32.128 cds I use_item_ring_of_collapsing_futures Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points bloodlust, temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades
0:32.128 stealthed Z shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points bloodlust, temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades
0:33.134 stealthed Z shadowstrike Fluffy_Pillow 80.8/100: 81% energy | 3.0/6: 50% combo_points bloodlust, temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades
0:34.139 finish N eviscerate Fluffy_Pillow 61.5/100: 62% energy | 6.0/6: 100% combo_points bloodlust, temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades
0:35.142 stealthed Z shadowstrike Fluffy_Pillow 81.2/100: 81% energy | 0.0/6: 0% combo_points bloodlust, temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6)
0:36.146 stealthed Z shadowstrike Fluffy_Pillow 62.0/100: 62% energy | 4.0/6: 67% combo_points bloodlust, temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6)
0:37.151 finish N eviscerate Fluffy_Pillow 42.7/100: 43% energy | 6.0/6: 100% combo_points bloodlust, temptation(3), master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6)
0:38.154 cds L goremaws_bite Fluffy_Pillow 62.4/100: 62% energy | 0.0/6: 0% combo_points bloodlust, temptation(3), master_of_subtlety, symbols_of_death, shadow_blades
0:39.159 finish M nightblade Fluffy_Pillow 82.2/100: 82% energy | 5.0/6: 83% combo_points bloodlust, temptation(3), master_of_subtlety, symbols_of_death, shadow_blades, goremaws_bite
0:40.164 build G backstab Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points bloodlust, temptation(3), master_of_subtlety, symbols_of_death, shadow_blades, goremaws_bite, finality_nightblade(5)
0:41.169 build G backstab Fluffy_Pillow 83.5/100: 83% energy | 3.0/6: 50% combo_points temptation(3), master_of_subtlety, symbols_of_death, shadow_blades, goremaws_bite, finality_nightblade(5)
0:42.172 finish N eviscerate Fluffy_Pillow 64.8/100: 65% energy | 5.0/6: 83% combo_points temptation(3), symbols_of_death, shadow_blades, goremaws_bite, finality_nightblade(5)
0:43.176 stealth_cds S shadow_dance Fluffy_Pillow 86.2/100: 86% energy | 0.0/6: 0% combo_points temptation(3), symbols_of_death, shadow_blades, goremaws_bite, finality_eviscerate(5), finality_nightblade(5)
0:43.176 stealthed X symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, goremaws_bite, finality_eviscerate(5), finality_nightblade(5)
0:43.176 stealthed Z shadowstrike Fluffy_Pillow 65.0/100: 65% energy | 0.0/6: 0% combo_points temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, goremaws_bite, death, finality_eviscerate(5), finality_nightblade(5)
0:44.183 finish N eviscerate Fluffy_Pillow 47.4/100: 47% energy | 5.0/6: 83% combo_points temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(5), finality_nightblade(5)
0:45.187 stealthed Z shadowstrike Fluffy_Pillow 63.7/100: 64% energy | 0.0/6: 0% combo_points temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(5)
0:46.191 stealthed Z shadowstrike Fluffy_Pillow 41.0/100: 41% energy | 3.0/6: 50% combo_points temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(5)
0:47.195 cds I use_item_ring_of_collapsing_futures Fluffy_Pillow 18.4/100: 18% energy | 6.0/6: 100% combo_points temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(5)
0:47.195 Waiting     1.487 sec 18.4/100: 18% energy | 6.0/6: 100% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(5)
0:48.682 finish N eviscerate Fluffy_Pillow 35.2/100: 35% energy | 6.0/6: 100% combo_points temptation(4), master_of_subtlety, symbols_of_death, shadow_blades, finality_nightblade(5)
0:49.687 stealth_cds V shadow_dance Fluffy_Pillow 51.5/100: 51% energy | 0.0/6: 0% combo_points temptation(4), master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(5)
0:49.687 stealthed Z shadowstrike Fluffy_Pillow 76.5/100: 76% energy | 0.0/6: 0% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(5)
0:50.691 stealthed Z shadowstrike Fluffy_Pillow 78.8/100: 79% energy | 3.0/6: 50% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(5)
0:51.695 finish M nightblade Fluffy_Pillow 81.2/100: 81% energy | 6.0/6: 100% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(5)
0:52.699 stealthed Z shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6)
0:53.704 stealthed Z shadowstrike Fluffy_Pillow 77.3/100: 77% energy | 4.0/6: 67% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6)
0:54.709 finish N eviscerate Fluffy_Pillow 54.7/100: 55% energy | 6.0/6: 100% combo_points temptation(4), master_of_subtlety, symbols_of_death, finality_eviscerate(6)
0:55.715 build G backstab Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points temptation(4), master_of_subtlety, symbols_of_death
0:56.719 build G backstab Fluffy_Pillow 76.3/100: 76% energy | 2.0/6: 33% combo_points temptation(4), master_of_subtlety, symbols_of_death
0:57.723 build G backstab Fluffy_Pillow 52.7/100: 53% energy | 3.0/6: 50% combo_points temptation(4), master_of_subtlety, symbols_of_death
0:58.728 Waiting     0.600 sec 29.0/100: 29% energy | 5.0/6: 83% combo_points temptation(4), master_of_subtlety, symbols_of_death
0:59.328 finish N eviscerate Fluffy_Pillow 35.8/100: 36% energy | 5.0/6: 83% combo_points temptation(4), master_of_subtlety, symbols_of_death
1:00.332 stealth_cds V shadow_dance Fluffy_Pillow 52.1/100: 52% energy | 0.0/6: 0% combo_points temptation(4), symbols_of_death, finality_eviscerate(5)
1:00.332 stealthed Z shadowstrike Fluffy_Pillow 77.1/100: 77% energy | 0.0/6: 0% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5)
1:01.338 stealthed Z shadowstrike Fluffy_Pillow 54.5/100: 54% energy | 2.0/6: 33% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5)
1:02.344 Waiting     0.300 sec 31.8/100: 32% energy | 5.0/6: 83% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5)
1:02.644 finish N eviscerate Fluffy_Pillow 35.2/100: 35% energy | 5.0/6: 83% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5)
1:03.649 stealthed Z shadowstrike Fluffy_Pillow 51.6/100: 52% energy | 0.0/6: 0% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death
1:04.653 Waiting     2.000 sec 28.9/100: 29% energy | 3.0/6: 50% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death
1:06.653 build G backstab Fluffy_Pillow 52.0/100: 52% energy | 3.0/6: 50% combo_points temptation(4), master_of_subtlety, symbols_of_death, arcane_enchant
1:07.659 Waiting     1.700 sec 29.7/100: 30% energy | 4.0/6: 67% combo_points temptation(4), master_of_subtlety, symbols_of_death, arcane_enchant
1:09.359 build G backstab Fluffy_Pillow 51.1/100: 51% energy | 4.0/6: 67% combo_points temptation(4), master_of_subtlety, symbols_of_death, arcane_enchant
1:10.364 Waiting     0.500 sec 28.8/100: 29% energy | 5.0/6: 83% combo_points temptation(4), symbols_of_death, arcane_enchant
1:10.864 finish N eviscerate Fluffy_Pillow 35.1/100: 35% energy | 6.0/6: 100% combo_points temptation(4), symbols_of_death, arcane_enchant
1:11.869 stealth_cds V shadow_dance Fluffy_Pillow 52.7/100: 53% energy | 0.0/6: 0% combo_points temptation(4), symbols_of_death, finality_eviscerate(6), arcane_enchant
1:11.869 stealthed Z shadowstrike Fluffy_Pillow 77.7/100: 78% energy | 0.0/6: 0% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6), arcane_enchant
1:12.873 stealthed Z shadowstrike Fluffy_Pillow 56.4/100: 56% energy | 2.0/6: 33% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6), arcane_enchant
1:13.877 Waiting     0.400 sec 35.0/100: 35% energy | 4.0/6: 67% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6), arcane_enchant
1:14.277 stealthed Z shadowstrike Fluffy_Pillow 40.1/100: 40% energy | 4.0/6: 67% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6), arcane_enchant
1:15.282 finish M nightblade Fluffy_Pillow 43.8/100: 44% energy | 6.0/6: 100% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6), arcane_enchant
1:16.288 stealthed Z shadowstrike Fluffy_Pillow 71.4/100: 71% energy | 0.0/6: 0% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6), finality_nightblade(6), arcane_enchant
1:17.291 Waiting     0.100 sec 50.1/100: 50% energy | 2.0/6: 33% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(6), finality_nightblade(6), arcane_enchant
1:17.391 build G backstab Fluffy_Pillow 51.3/100: 51% energy | 2.0/6: 33% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(6), finality_nightblade(6), arcane_enchant
1:18.395 Waiting     1.800 sec 29.0/100: 29% energy | 3.0/6: 50% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(6), finality_nightblade(6), arcane_enchant
1:20.195 build G backstab Fluffy_Pillow 51.7/100: 52% energy | 4.0/6: 67% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(6), finality_nightblade(6), arcane_enchant
1:21.198 Waiting     0.500 sec 29.3/100: 29% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(6), finality_nightblade(6), arcane_enchant
1:21.698 finish N eviscerate Fluffy_Pillow 35.6/100: 36% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(6), finality_nightblade(6), arcane_enchant
1:22.702 stealth_cds V shadow_dance Fluffy_Pillow 53.3/100: 53% energy | 0.0/6: 0% combo_points symbols_of_death, finality_nightblade(6), arcane_enchant
1:22.702 stealthed X symbols_of_death Fluffy_Pillow 78.3/100: 78% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(6), arcane_enchant
1:22.702 stealthed Z shadowstrike Fluffy_Pillow 43.3/100: 43% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, death, finality_nightblade(6), arcane_enchant
1:23.706 Waiting     1.445 sec 21.9/100: 22% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(6), arcane_enchant
1:25.151 stealthed Z shadowstrike Fluffy_Pillow 40.1/100: 40% energy | 3.0/6: 50% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(6), arcane_enchant
1:26.156 Waiting     1.493 sec 18.8/100: 19% energy | 5.0/6: 83% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(6), arcane_enchant
1:27.649 finish N eviscerate Fluffy_Pillow 35.7/100: 36% energy | 5.0/6: 83% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(6)
1:28.652 build G backstab Fluffy_Pillow 52.1/100: 52% energy | 2.0/6: 33% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5), finality_nightblade(6)
1:29.657 Waiting     2.100 sec 28.4/100: 28% energy | 3.0/6: 50% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5), finality_nightblade(6)
1:31.757 build G backstab Fluffy_Pillow 52.1/100: 52% energy | 3.0/6: 50% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5), finality_nightblade(6)
1:32.763 finish M nightblade Fluffy_Pillow 28.5/100: 28% energy | 5.0/6: 83% combo_points symbols_of_death, finality_eviscerate(5), finality_nightblade(6)
1:33.767 stealth_cds W shadow_dance Fluffy_Pillow 54.8/100: 55% energy | 0.0/6: 0% combo_points symbols_of_death, finality_eviscerate(5)
1:33.767 stealthed Z shadowstrike Fluffy_Pillow 79.8/100: 80% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5)
1:34.772 stealthed Z shadowstrike Fluffy_Pillow 57.2/100: 57% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5)
1:35.777 Waiting     0.500 sec 34.5/100: 34% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5)
1:36.277 stealthed Z shadowstrike Fluffy_Pillow 40.1/100: 40% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5)
1:37.281 Waiting     1.566 sec 17.5/100: 17% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5)
1:38.847 finish N eviscerate Fluffy_Pillow 35.2/100: 35% energy | 6.0/6: 100% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5)
1:39.852 cds L goremaws_bite Fluffy_Pillow 51.5/100: 51% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death
1:40.858 build G backstab Fluffy_Pillow 67.9/100: 68% energy | 3.0/6: 50% combo_points master_of_subtlety, symbols_of_death, goremaws_bite
1:41.863 Waiting     0.200 sec 49.2/100: 49% energy | 4.0/6: 67% combo_points master_of_subtlety, symbols_of_death, goremaws_bite
1:42.063 build G backstab Fluffy_Pillow 51.5/100: 51% energy | 4.0/6: 67% combo_points master_of_subtlety, symbols_of_death, goremaws_bite
1:43.067 Waiting     0.200 sec 32.8/100: 33% energy | 6.0/6: 100% combo_points master_of_subtlety, symbols_of_death, goremaws_bite
1:43.267 finish N eviscerate Fluffy_Pillow 35.0/100: 35% energy | 6.0/6: 100% combo_points master_of_subtlety, symbols_of_death, goremaws_bite
1:44.272 stealth_cds W shadow_dance Fluffy_Pillow 56.4/100: 56% energy | 0.0/6: 0% combo_points symbols_of_death, goremaws_bite, finality_eviscerate(6)
1:44.272 stealthed Z shadowstrike Fluffy_Pillow 81.4/100: 81% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, goremaws_bite, finality_eviscerate(6)
1:45.277 stealthed Z shadowstrike Fluffy_Pillow 88.7/100: 89% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, goremaws_bite, finality_eviscerate(6)
1:46.282 stealthed Z shadowstrike Fluffy_Pillow 71.1/100: 71% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6)
1:47.284 finish M nightblade Fluffy_Pillow 48.4/100: 48% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6)
1:48.289 stealthed X symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6), finality_nightblade(6)
1:48.289 stealthed Z shadowstrike Fluffy_Pillow 65.0/100: 65% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, death, finality_eviscerate(6), finality_nightblade(6)
1:49.294 Waiting     0.800 sec 42.3/100: 42% energy | 2.0/6: 33% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(6), finality_nightblade(6)
1:50.094 build G backstab Fluffy_Pillow 51.4/100: 51% energy | 2.0/6: 33% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(6), finality_nightblade(6)
1:51.101 Waiting     2.100 sec 27.7/100: 28% energy | 3.0/6: 50% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(6), finality_nightblade(6)
1:53.201 build G backstab Fluffy_Pillow 51.4/100: 51% energy | 4.0/6: 67% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(6), finality_nightblade(6)
1:54.206 Waiting     0.700 sec 27.8/100: 28% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(6), finality_nightblade(6)
1:54.906 finish N eviscerate Fluffy_Pillow 35.7/100: 36% energy | 5.0/6: 83% combo_points symbols_of_death, finality_eviscerate(6), finality_nightblade(6)
1:55.910 stealth_cds W shadow_dance Fluffy_Pillow 52.0/100: 52% energy | 0.0/6: 0% combo_points symbols_of_death, finality_nightblade(6)
1:55.910 stealthed Z shadowstrike Fluffy_Pillow 77.0/100: 77% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(6)
1:56.915 stealthed Z shadowstrike Fluffy_Pillow 79.4/100: 79% energy | 3.0/6: 50% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(6)
1:57.920 finish N eviscerate Fluffy_Pillow 56.7/100: 57% energy | 5.0/6: 83% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(6)
1:58.924 stealthed Z shadowstrike Fluffy_Pillow 73.1/100: 73% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5), finality_nightblade(6)
1:59.928 stealthed Z shadowstrike Fluffy_Pillow 50.4/100: 50% energy | 3.0/6: 50% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5), finality_nightblade(6)
2:00.935 Waiting     0.700 sec 27.8/100: 28% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5), finality_nightblade(6)
2:01.635 finish N eviscerate Fluffy_Pillow 35.7/100: 36% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5), finality_nightblade(6)
2:02.638 build G backstab Fluffy_Pillow 52.0/100: 52% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, finality_nightblade(6)
2:03.643 Waiting     2.100 sec 28.3/100: 28% energy | 1.0/6: 17% combo_points master_of_subtlety, symbols_of_death, finality_nightblade(6)
2:05.743 build G backstab Fluffy_Pillow 52.0/100: 52% energy | 2.0/6: 33% combo_points master_of_subtlety, symbols_of_death, finality_nightblade(6)
2:06.749 Waiting     2.100 sec 28.4/100: 28% energy | 3.0/6: 50% combo_points symbols_of_death, finality_nightblade(6)
2:08.849 build G backstab Fluffy_Pillow 52.1/100: 52% energy | 3.0/6: 50% combo_points symbols_of_death, finality_nightblade(6)
2:09.852 finish M nightblade Fluffy_Pillow 28.4/100: 28% energy | 5.0/6: 83% combo_points symbols_of_death, finality_nightblade(6)
2:10.856 stealth_cds W shadow_dance Fluffy_Pillow 54.7/100: 55% energy | 0.0/6: 0% combo_points symbols_of_death
2:10.856 stealthed Z shadowstrike Fluffy_Pillow 79.7/100: 80% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
2:11.860 stealthed Z shadowstrike Fluffy_Pillow 57.1/100: 57% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
2:12.865 Waiting     0.500 sec 34.4/100: 34% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
2:13.365 stealthed Z shadowstrike Fluffy_Pillow 40.1/100: 40% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
2:14.369 finish N eviscerate Fluffy_Pillow 42.4/100: 42% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
2:15.374 stealthed X symbols_of_death Fluffy_Pillow 98.7/100: 99% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6)
2:15.374 stealthed Z shadowstrike Fluffy_Pillow 63.7/100: 64% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, death, finality_eviscerate(6)
2:16.379 stealth_cds T vanish Fluffy_Pillow 66.1/100: 66% energy | 2.0/6: 33% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(6)
2:16.379 stealthed Z shadowstrike Fluffy_Pillow 91.1/100: 91% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, vanish, symbols_of_death, finality_eviscerate(6)
2:17.383 finish N eviscerate Fluffy_Pillow 68.4/100: 68% energy | 5.0/6: 83% combo_points master_of_subtlety_aura, vanish, subterfuge, symbols_of_death, finality_eviscerate(6)
2:18.387 stealthed Z shadowstrike Fluffy_Pillow 84.8/100: 85% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, vanish, subterfuge, symbols_of_death
2:19.392 build G backstab Fluffy_Pillow 87.1/100: 87% energy | 2.0/6: 33% combo_points master_of_subtlety, symbols_of_death
2:20.397 build G backstab Fluffy_Pillow 63.4/100: 63% energy | 3.0/6: 50% combo_points master_of_subtlety, symbols_of_death
2:21.402 Waiting     1.000 sec 39.8/100: 40% energy | 4.0/6: 67% combo_points master_of_subtlety, symbols_of_death
2:22.402 build G backstab Fluffy_Pillow 51.1/100: 51% energy | 4.0/6: 67% combo_points master_of_subtlety, symbols_of_death
2:23.407 Waiting     0.500 sec 27.4/100: 27% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death
2:23.907 finish M nightblade Fluffy_Pillow 33.1/100: 33% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death
2:24.911 stealth_cds U sprint Fluffy_Pillow 59.4/100: 59% energy | 2.0/6: 33% combo_points symbols_of_death, finality_nightblade(5)
2:24.911 build G backstab Fluffy_Pillow 59.4/100: 59% energy | 2.0/6: 33% combo_points sprint, symbols_of_death, finality_nightblade(5), faster_than_light_trigger
2:25.916 Waiting     1.400 sec 35.7/100: 36% energy | 3.0/6: 50% combo_points sprint, symbols_of_death, finality_nightblade(5), faster_than_light_trigger
2:27.316 build G backstab Fluffy_Pillow 51.5/100: 52% energy | 3.0/6: 50% combo_points sprint, symbols_of_death, finality_nightblade(5), faster_than_light_trigger
2:28.322 stealthed Z shadowstrike Fluffy_Pillow 52.9/100: 53% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, vanish, subterfuge, sprint, symbols_of_death, finality_nightblade(5)
2:29.325 Waiting     0.500 sec 30.2/100: 30% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, vanish, subterfuge, sprint, symbols_of_death, finality_nightblade(5)
2:29.825 finish N eviscerate Fluffy_Pillow 35.9/100: 36% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, vanish, subterfuge, sprint, symbols_of_death, finality_nightblade(5)
2:30.829 stealthed Z shadowstrike Fluffy_Pillow 92.2/100: 92% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, vanish, subterfuge, sprint, symbols_of_death, finality_eviscerate(6), finality_nightblade(5)
2:31.835 build G backstab Fluffy_Pillow 94.6/100: 95% energy | 4.0/6: 67% combo_points master_of_subtlety, sprint, symbols_of_death, finality_eviscerate(6), finality_nightblade(5)
2:32.838 finish N eviscerate Fluffy_Pillow 70.9/100: 71% energy | 5.0/6: 83% combo_points master_of_subtlety, sprint, symbols_of_death, finality_eviscerate(6), finality_nightblade(5)
2:33.843 stealth_cds V shadow_dance Fluffy_Pillow 87.2/100: 87% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, finality_nightblade(5)
2:33.843 stealthed X symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(5)
2:33.843 stealthed Z shadowstrike Fluffy_Pillow 65.0/100: 65% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, death, finality_nightblade(5)
2:34.846 stealthed Z shadowstrike Fluffy_Pillow 42.3/100: 42% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(5)
2:35.851 stealthed Z shadowstrike Fluffy_Pillow 44.7/100: 45% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(5)
2:36.855 finish M nightblade Fluffy_Pillow 47.0/100: 47% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(5)
2:37.861 stealthed Z shadowstrike Fluffy_Pillow 73.4/100: 73% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
2:38.865 Waiting     0.100 sec 50.7/100: 51% energy | 4.0/6: 67% combo_points master_of_subtlety, symbols_of_death
2:38.965 build G backstab Fluffy_Pillow 51.8/100: 52% energy | 4.0/6: 67% combo_points master_of_subtlety, symbols_of_death
2:39.969 Waiting     0.700 sec 28.2/100: 28% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death
2:40.669 finish N eviscerate Fluffy_Pillow 36.1/100: 36% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death
2:41.674 cds L goremaws_bite Fluffy_Pillow 52.4/100: 52% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5)
2:42.677 build G backstab Fluffy_Pillow 68.7/100: 69% energy | 4.0/6: 67% combo_points master_of_subtlety, symbols_of_death, goremaws_bite, finality_eviscerate(5)
2:43.681 finish N eviscerate Fluffy_Pillow 50.1/100: 50% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death, goremaws_bite, finality_eviscerate(5)
2:44.685 stealth_cds V shadow_dance Fluffy_Pillow 71.4/100: 71% energy | 0.0/6: 0% combo_points symbols_of_death, goremaws_bite
2:44.685 stealthed Z shadowstrike Fluffy_Pillow 96.4/100: 96% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, goremaws_bite
2:45.691 stealthed Z shadowstrike Fluffy_Pillow 78.7/100: 79% energy | 3.0/6: 50% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, goremaws_bite
2:46.698 finish N eviscerate Fluffy_Pillow 61.1/100: 61% energy | 5.0/6: 83% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, goremaws_bite
2:47.701 stealthed Z shadowstrike Fluffy_Pillow 82.4/100: 82% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5)
2:48.706 stealthed Z shadowstrike Fluffy_Pillow 59.8/100: 60% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5)
2:49.709 build G backstab Fluffy_Pillow 62.1/100: 62% energy | 4.0/6: 67% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5)
2:50.714 finish N eviscerate Fluffy_Pillow 38.4/100: 38% energy | 6.0/6: 100% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5)
2:51.718 stealth_cds W shadow_dance Fluffy_Pillow 54.8/100: 55% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death
2:51.718 stealthed Z shadowstrike Fluffy_Pillow 79.8/100: 80% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
2:52.722 stealthed Z shadowstrike Fluffy_Pillow 57.1/100: 57% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
2:53.726 Waiting     0.100 sec 34.4/100: 34% energy | 5.0/6: 83% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
2:53.826 finish N eviscerate Fluffy_Pillow 35.6/100: 36% energy | 5.0/6: 83% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
2:54.829 stealthed Z shadowstrike Fluffy_Pillow 51.9/100: 52% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5)
2:55.831 stealthed Z shadowstrike Fluffy_Pillow 54.2/100: 54% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5)
2:56.835 Waiting     1.400 sec 31.5/100: 32% energy | 4.0/6: 67% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5)
2:58.235 finish M nightblade Fluffy_Pillow 47.3/100: 47% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5)
2:59.240 stealth_cds W shadow_dance Fluffy_Pillow 73.7/100: 74% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5), finality_nightblade(5)
2:59.240 stealthed X symbols_of_death Fluffy_Pillow 98.7/100: 99% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5), finality_nightblade(5)
2:59.240 stealthed Z shadowstrike Fluffy_Pillow 63.7/100: 64% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, death, finality_eviscerate(5), finality_nightblade(5)
3:00.246 cds K shadow_blades Fluffy_Pillow 41.0/100: 41% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5), finality_nightblade(5)
3:00.246 cds H potion Fluffy_Pillow 41.0/100: 41% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(5), finality_nightblade(5)
3:00.246 cds J use_item_draught_of_souls Fluffy_Pillow 41.0/100: 41% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(5), finality_nightblade(5), potion_of_the_old_war
3:03.246 stealthed Z shadowstrike Fluffy_Pillow 74.9/100: 75% energy | 3.0/6: 50% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(5), finality_nightblade(5), potion_of_the_old_war
3:04.252 finish N eviscerate Fluffy_Pillow 52.3/100: 52% energy | 6.0/6: 100% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(5), finality_nightblade(5), potion_of_the_old_war
3:05.256 build G backstab Fluffy_Pillow 68.6/100: 69% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_nightblade(5), potion_of_the_old_war
3:06.259 Waiting     0.600 sec 44.9/100: 45% energy | 3.0/6: 50% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_nightblade(5), potion_of_the_old_war
3:06.859 build G backstab Fluffy_Pillow 51.7/100: 52% energy | 3.0/6: 50% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_nightblade(5), potion_of_the_old_war
3:07.864 Waiting     0.700 sec 28.0/100: 28% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_nightblade(5), potion_of_the_old_war
3:08.564 finish N eviscerate Fluffy_Pillow 35.9/100: 36% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_nightblade(5), potion_of_the_old_war
3:09.567 stealth_cds W shadow_dance Fluffy_Pillow 52.3/100: 52% energy | 1.0/6: 17% combo_points symbols_of_death, shadow_blades, finality_eviscerate(5), finality_nightblade(5), potion_of_the_old_war
3:09.567 stealthed Z shadowstrike Fluffy_Pillow 77.3/100: 77% energy | 1.0/6: 17% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(5), finality_nightblade(5), potion_of_the_old_war
3:10.570 stealthed Z shadowstrike Fluffy_Pillow 54.6/100: 55% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(5), finality_nightblade(5), potion_of_the_old_war
3:11.575 finish M nightblade Fluffy_Pillow 31.9/100: 32% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(5), finality_nightblade(5), potion_of_the_old_war
3:12.581 stealthed X symbols_of_death Fluffy_Pillow 98.3/100: 98% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(5), potion_of_the_old_war
3:12.581 stealthed Z shadowstrike Fluffy_Pillow 63.3/100: 63% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, death, finality_eviscerate(5), potion_of_the_old_war
3:13.585 stealthed Z shadowstrike Fluffy_Pillow 40.6/100: 41% energy | 3.0/6: 50% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(5), potion_of_the_old_war
3:14.589 Waiting     1.524 sec 18.0/100: 18% energy | 6.0/6: 100% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(5), potion_of_the_old_war
3:16.113 finish N eviscerate Fluffy_Pillow 35.2/100: 35% energy | 6.0/6: 100% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(5), potion_of_the_old_war
3:17.117 build G backstab Fluffy_Pillow 51.5/100: 51% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, shadow_blades, potion_of_the_old_war
3:18.121 Waiting     2.100 sec 27.8/100: 28% energy | 3.0/6: 50% combo_points master_of_subtlety, symbols_of_death, shadow_blades, potion_of_the_old_war
3:20.221 build G backstab Fluffy_Pillow 51.5/100: 52% energy | 3.0/6: 50% combo_points symbols_of_death, shadow_blades, potion_of_the_old_war
3:21.225 Waiting     0.700 sec 27.9/100: 28% energy | 5.0/6: 83% combo_points symbols_of_death, shadow_blades, potion_of_the_old_war
3:21.925 finish N eviscerate Fluffy_Pillow 35.8/100: 36% energy | 5.0/6: 83% combo_points symbols_of_death, shadow_blades, potion_of_the_old_war
3:22.930 build G backstab Fluffy_Pillow 52.1/100: 52% energy | 2.0/6: 33% combo_points symbols_of_death, shadow_blades, finality_eviscerate(5), potion_of_the_old_war
3:23.934 Waiting     1.400 sec 28.4/100: 28% energy | 4.0/6: 67% combo_points symbols_of_death, shadow_blades, finality_eviscerate(5), potion_of_the_old_war
3:25.334 finish N eviscerate Fluffy_Pillow 44.2/100: 44% energy | 6.0/6: 100% combo_points symbols_of_death, shadow_blades, finality_eviscerate(5)
3:26.339 stealth_cds W shadow_dance Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points symbols_of_death, shadow_blades
3:26.339 stealthed X symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades
3:26.339 stealthed Z shadowstrike Fluffy_Pillow 65.0/100: 65% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, death
3:27.344 stealthed Z shadowstrike Fluffy_Pillow 42.3/100: 42% energy | 3.0/6: 50% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades
3:28.348 Waiting     1.371 sec 19.7/100: 20% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades
3:29.719 finish N eviscerate Fluffy_Pillow 35.2/100: 35% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades
3:30.725 stealthed Z shadowstrike Fluffy_Pillow 51.5/100: 52% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6)
3:31.729 finish N eviscerate Fluffy_Pillow 53.8/100: 54% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6)
3:32.733 stealth_cds W shadow_dance Fluffy_Pillow 70.2/100: 70% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, shadow_blades
3:32.733 stealthed Z shadowstrike Fluffy_Pillow 95.2/100: 95% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades
3:33.740 stealthed Z shadowstrike Fluffy_Pillow 72.5/100: 73% energy | 3.0/6: 50% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades
3:34.746 finish M nightblade Fluffy_Pillow 49.9/100: 50% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades
3:35.749 stealthed Z shadowstrike Fluffy_Pillow 76.2/100: 76% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6)
3:36.755 stealthed Z shadowstrike Fluffy_Pillow 53.6/100: 54% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6)
3:37.759 Waiting     0.400 sec 30.9/100: 31% energy | 6.0/6: 100% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_nightblade(6)
3:38.159 finish N eviscerate Fluffy_Pillow 35.4/100: 35% energy | 6.0/6: 100% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_nightblade(6)
3:39.164 build G backstab Fluffy_Pillow 51.8/100: 52% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6)
3:40.168 Waiting     2.100 sec 28.1/100: 28% energy | 4.0/6: 67% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6)
3:42.268 build G backstab Fluffy_Pillow 51.8/100: 52% energy | 4.0/6: 67% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6)
3:43.273 Waiting     0.700 sec 28.2/100: 28% energy | 6.0/6: 100% combo_points symbols_of_death, finality_eviscerate(6), finality_nightblade(6)
3:43.973 finish N eviscerate Fluffy_Pillow 36.1/100: 36% energy | 6.0/6: 100% combo_points symbols_of_death, finality_eviscerate(6), finality_nightblade(6)
3:44.977 cds L goremaws_bite Fluffy_Pillow 52.4/100: 52% energy | 1.0/6: 17% combo_points symbols_of_death, finality_nightblade(6)
3:45.980 build G backstab Fluffy_Pillow 68.7/100: 69% energy | 4.0/6: 67% combo_points symbols_of_death, goremaws_bite, finality_nightblade(6)
3:46.983 finish N eviscerate Fluffy_Pillow 50.0/100: 50% energy | 5.0/6: 83% combo_points symbols_of_death, goremaws_bite, finality_nightblade(6)
3:47.988 build G backstab Fluffy_Pillow 71.4/100: 71% energy | 2.0/6: 33% combo_points symbols_of_death, goremaws_bite, finality_eviscerate(5), finality_nightblade(6)
3:48.993 build G backstab Fluffy_Pillow 52.7/100: 53% energy | 3.0/6: 50% combo_points symbols_of_death, goremaws_bite, finality_eviscerate(5), finality_nightblade(6)
3:49.997 Waiting     1.100 sec 34.1/100: 34% energy | 4.0/6: 67% combo_points symbols_of_death, goremaws_bite, finality_eviscerate(5), finality_nightblade(6)
3:51.097 build G backstab Fluffy_Pillow 51.5/100: 51% energy | 4.0/6: 67% combo_points symbols_of_death, finality_eviscerate(5), finality_nightblade(6)
3:52.102 finish M nightblade Fluffy_Pillow 27.8/100: 28% energy | 5.0/6: 83% combo_points symbols_of_death, finality_eviscerate(5), finality_nightblade(6)
3:53.108 build G backstab Fluffy_Pillow 54.2/100: 54% energy | 2.0/6: 33% combo_points symbols_of_death, finality_eviscerate(5)
3:54.111 Waiting     1.700 sec 30.7/100: 31% energy | 3.0/6: 50% combo_points symbols_of_death, finality_eviscerate(5), arcane_enchant
3:55.811 build G backstab Fluffy_Pillow 52.1/100: 52% energy | 3.0/6: 50% combo_points symbols_of_death, finality_eviscerate(5), arcane_enchant
3:56.816 Waiting     0.500 sec 29.7/100: 30% energy | 4.0/6: 67% combo_points symbols_of_death, finality_eviscerate(5), arcane_enchant
3:57.316 finish N eviscerate Fluffy_Pillow 36.0/100: 36% energy | 5.0/6: 83% combo_points symbols_of_death, finality_eviscerate(5), arcane_enchant
3:58.320 stealth_cds V shadow_dance Fluffy_Pillow 53.7/100: 54% energy | 0.0/6: 0% combo_points symbols_of_death, arcane_enchant
3:58.320 stealthed Z shadowstrike Fluffy_Pillow 78.7/100: 79% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, arcane_enchant
3:59.323 stealthed Z shadowstrike Fluffy_Pillow 57.3/100: 57% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, arcane_enchant
4:00.328 finish N eviscerate Fluffy_Pillow 61.0/100: 61% energy | 5.0/6: 83% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, arcane_enchant
4:01.332 stealthed Z shadowstrike Fluffy_Pillow 78.7/100: 79% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5), arcane_enchant
4:02.337 stealthed X symbols_of_death Fluffy_Pillow 57.3/100: 57% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5), arcane_enchant
4:02.337 Waiting     2.312 sec 22.3/100: 22% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, death, finality_eviscerate(5), arcane_enchant
4:04.649 build G backstab Fluffy_Pillow 51.5/100: 51% energy | 3.0/6: 50% combo_points master_of_subtlety, symbols_of_death, death, finality_eviscerate(5), arcane_enchant
4:05.655 Waiting     1.800 sec 29.1/100: 29% energy | 4.0/6: 67% combo_points master_of_subtlety, symbols_of_death, death, finality_eviscerate(5), arcane_enchant
4:07.455 build G backstab Fluffy_Pillow 51.8/100: 52% energy | 4.0/6: 67% combo_points master_of_subtlety, symbols_of_death, death, finality_eviscerate(5), arcane_enchant
4:08.460 finish M nightblade Fluffy_Pillow 29.5/100: 29% energy | 6.0/6: 100% combo_points symbols_of_death, death, finality_eviscerate(5), arcane_enchant
4:09.463 stealth_cds W shadow_dance Fluffy_Pillow 97.1/100: 97% energy | 0.0/6: 0% combo_points symbols_of_death, death, finality_eviscerate(5), finality_nightblade(6), arcane_enchant
4:09.463 stealthed Z shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, death, finality_eviscerate(5), finality_nightblade(6), arcane_enchant
4:10.468 stealthed Z shadowstrike Fluffy_Pillow 78.7/100: 79% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5), finality_nightblade(6), arcane_enchant
4:11.473 finish N eviscerate Fluffy_Pillow 57.3/100: 57% energy | 5.0/6: 83% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5), finality_nightblade(6), arcane_enchant
4:12.478 stealthed Z shadowstrike Fluffy_Pillow 75.0/100: 75% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(6), arcane_enchant
4:13.484 stealthed Z shadowstrike Fluffy_Pillow 53.7/100: 54% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(6), arcane_enchant
4:14.489 build G backstab Fluffy_Pillow 56.7/100: 57% energy | 4.0/6: 67% combo_points master_of_subtlety, symbols_of_death, finality_nightblade(6)
4:15.493 Waiting     0.200 sec 33.0/100: 33% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death, finality_nightblade(6)
4:15.693 finish N eviscerate Fluffy_Pillow 35.3/100: 35% energy | 6.0/6: 100% combo_points master_of_subtlety, symbols_of_death, finality_nightblade(6)
4:16.697 stealth_cds T vanish Fluffy_Pillow 51.6/100: 52% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(6), finality_nightblade(6)
4:16.697 stealthed Z shadowstrike Fluffy_Pillow 76.6/100: 77% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, vanish, symbols_of_death, finality_eviscerate(6), finality_nightblade(6)
4:17.701 stealthed Z shadowstrike Fluffy_Pillow 78.9/100: 79% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, vanish, subterfuge, symbols_of_death, finality_eviscerate(6), finality_nightblade(6)
4:18.704 stealthed Z shadowstrike Fluffy_Pillow 81.3/100: 81% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, vanish, subterfuge, symbols_of_death, finality_eviscerate(6), finality_nightblade(6)
4:19.708 finish N eviscerate Fluffy_Pillow 83.6/100: 84% energy | 6.0/6: 100% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(6), finality_nightblade(6)
4:20.712 stealth_cds V shadow_dance Fluffy_Pillow 99.9/100: 100% energy | 1.0/6: 17% combo_points master_of_subtlety, symbols_of_death, finality_nightblade(6)
4:20.712 stealthed X symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(6)
4:20.712 stealthed Z shadowstrike Fluffy_Pillow 65.0/100: 65% energy | 1.0/6: 17% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, death, finality_nightblade(6)
4:21.716 stealthed Z shadowstrike Fluffy_Pillow 42.3/100: 42% energy | 3.0/6: 50% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(6)
4:22.719 Waiting     0.573 sec 19.7/100: 20% energy | 5.0/6: 83% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(6)
4:23.292 finish M nightblade Fluffy_Pillow 26.1/100: 26% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(6)
4:24.295 stealthed Z shadowstrike Fluffy_Pillow 52.4/100: 52% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
4:25.298 stealthed Z shadowstrike Fluffy_Pillow 54.8/100: 55% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
4:26.302 Waiting     0.800 sec 32.1/100: 32% energy | 4.0/6: 67% combo_points master_of_subtlety, symbols_of_death
4:27.102 finish N eviscerate Fluffy_Pillow 41.1/100: 41% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death
4:28.106 stealth_cds U sprint Fluffy_Pillow 57.5/100: 57% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5)
4:28.106 stealth_cds W shadow_dance Fluffy_Pillow 57.5/100: 57% energy | 0.0/6: 0% combo_points master_of_subtlety, sprint, symbols_of_death, finality_eviscerate(5), faster_than_light_trigger
4:28.106 stealthed Z shadowstrike Fluffy_Pillow 82.5/100: 82% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, sprint, symbols_of_death, finality_eviscerate(5), faster_than_light_trigger
4:29.111 stealthed Z shadowstrike Fluffy_Pillow 59.8/100: 60% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, sprint, symbols_of_death, finality_eviscerate(5), faster_than_light_trigger
4:30.115 Waiting     0.300 sec 37.1/100: 37% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, shadow_dance, sprint, symbols_of_death, finality_eviscerate(5), faster_than_light_trigger
4:30.415 stealthed Z shadowstrike Fluffy_Pillow 40.5/100: 41% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, shadow_dance, sprint, symbols_of_death, finality_eviscerate(5), faster_than_light_trigger
4:31.420 finish N eviscerate Fluffy_Pillow 42.9/100: 43% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, vanish, subterfuge, sprint, symbols_of_death, finality_eviscerate(5)
4:32.425 stealthed Z shadowstrike Fluffy_Pillow 59.2/100: 59% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, vanish, subterfuge, sprint, symbols_of_death
4:33.430 Waiting     0.400 sec 36.6/100: 37% energy | 3.0/6: 50% combo_points master_of_subtlety, vanish, subterfuge, sprint, symbols_of_death
4:33.830 stealthed Z shadowstrike Fluffy_Pillow 41.1/100: 41% energy | 3.0/6: 50% combo_points master_of_subtlety, vanish, subterfuge, sprint, symbols_of_death
4:34.837 cds J use_item_draught_of_souls Fluffy_Pillow 68.4/100: 68% energy | 5.0/6: 83% combo_points master_of_subtlety, sprint, symbols_of_death
4:37.837 finish N eviscerate Fluffy_Pillow 100.0/100: 100% energy | 6.0/6: 100% combo_points master_of_subtlety, symbols_of_death
4:38.841 stealth_cds W shadow_dance Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(6)
4:38.841 stealthed X symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6)
4:38.841 stealthed Z shadowstrike Fluffy_Pillow 65.0/100: 65% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, death, finality_eviscerate(6)
4:39.845 stealthed Z shadowstrike Fluffy_Pillow 42.3/100: 42% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6)
4:40.849 Waiting     1.372 sec 19.7/100: 20% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6)
4:42.221 finish N eviscerate Fluffy_Pillow 35.2/100: 35% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6)
4:43.226 stealthed Z shadowstrike Fluffy_Pillow 51.5/100: 51% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
4:44.230 Waiting     0.700 sec 28.8/100: 29% energy | 3.0/6: 50% combo_points master_of_subtlety, symbols_of_death
4:44.930 cds L goremaws_bite Fluffy_Pillow 36.7/100: 37% energy | 3.0/6: 50% combo_points master_of_subtlety, symbols_of_death
4:45.982 finish N eviscerate Fluffy_Pillow 53.6/100: 54% energy | 6.0/6: 100% combo_points master_of_subtlety, symbols_of_death, goremaws_bite
4:46.986 stealth_cds W shadow_dance Fluffy_Pillow 74.9/100: 75% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, goremaws_bite, finality_eviscerate(6)
4:46.986 stealthed Z shadowstrike Fluffy_Pillow 99.9/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, goremaws_bite, finality_eviscerate(6)
4:47.992 stealthed Z shadowstrike Fluffy_Pillow 82.3/100: 82% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, goremaws_bite, finality_eviscerate(6)
4:48.995 stealthed Z shadowstrike Fluffy_Pillow 64.6/100: 65% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, goremaws_bite, finality_eviscerate(6)
4:50.000 finish N eviscerate Fluffy_Pillow 72.0/100: 72% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, goremaws_bite, finality_eviscerate(6)
4:51.005 stealthed Z shadowstrike Fluffy_Pillow 93.3/100: 93% energy | 1.0/6: 17% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
4:52.010 build G backstab Fluffy_Pillow 70.7/100: 71% energy | 3.0/6: 50% combo_points master_of_subtlety, symbols_of_death
4:53.013 Waiting     0.400 sec 47.0/100: 47% energy | 4.0/6: 67% combo_points master_of_subtlety, symbols_of_death
4:53.413 build G backstab Fluffy_Pillow 51.5/100: 51% energy | 4.0/6: 67% combo_points master_of_subtlety, symbols_of_death

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 8806 8481 0
Agility 30616 28910 18504 (13012)
Stamina 48391 48391 28183
Intellect 5325 5000 0
Spirit 0 0 0
Health 2903460 2903460 0
Energy 100 100 0
Combo Points 6 6 0
Crit 23.64% 23.64% 5456
Haste 12.88% 12.88% 4831
Damage / Heal Versatility 9.03% 8.23% 3909
Attack Power 30616 28910 0
Mastery 80.81% 80.81% 8510
Armor 2297 2297 2297
Run Speed 8 0 0

Gear

Source Slot Average Item Level: 891.00
Local Head Cowl of Fright
ilevel: 885, stats: { 300 Armor, +2829 Sta, +1886 AgiInt, +1015 Mastery, +547 Crit, +1076 unknown }
Local Neck Sea Fan Pendant
ilevel: 880, stats: { +1519 Sta, +1633 Vers, +965 Mastery }, enchant: mark_of_the_hidden_satyr
Local Shoulders Steelgazer Hide Mantle
ilevel: 880, stats: { 273 Armor, +1351 AgiInt, +2027 Sta, +673 Haste, +476 Vers, +771 unknown }
Local Shirt Common Gray Shirt
ilevel: 1
Local Chest Biornskin Vest
ilevel: 890, stats: { 376 Armor, +1977 AgiInt, +2965 Sta, +1034 Crit, +557 Mastery }
Local Waist Strand of Whelk Shells
ilevel: 880, stats: { 205 Armor, +2026 Sta, +1351 AgiInt, +673 Haste, +476 Mastery }, gems: { +150 Mastery }
Local Legs Legwraps of Unworthy Souls
ilevel: 880, stats: { 318 Armor, +2701 Sta, +1801 AgiInt, +964 Mastery, +570 Haste }
Local Feet Shadow Satyr's Walk
ilevel: 910, stats: { 276 Armor, +2680 Sta, +1786 Agi, +827 Haste, +459 Mastery }
Local Wrists Denial of the Half-Giants
ilevel: 910, stats: { 176 Armor, +2010 Sta, +1340 Agi, +276 Crit, +689 Mastery }
Local Hands Cruel Vice Grips
ilevel: 885, stats: { 231 Armor, +2122 Sta, +1415 AgiInt, +686 Crit, +485 Mastery }
Local Finger1 Grubby Silver Ring
ilevel: 880, stats: { +1519 Sta, +1484 Crit, +1114 Vers }, gems: { +150 Vers }, enchant: { +200 Mastery }
Local Finger2 Ring of Collapsing Futures
ilevel: 870, stats: { +1385 Sta, +1677 Mastery, +768 Haste, +419 Avoidance }, enchant: { +200 Vers }
Local Trinket1 Entwined Elemental Foci
ilevel: 910, stats: { +2264 StrAgi }
Local Trinket2 Draught of Souls
ilevel: 910, stats: { +1225 Haste }
Local Back Drape of the Mana-Starved
ilevel: 875, stats: { 142 Armor, +1450 Sta, +967 StrAgiInt, +586 Crit, +259 Vers }, gems: { +200 Agi }, enchant: { +200 Agi }
Local Main Hand Fangs of the Devourer
ilevel: 906, weapon: { 3844 - 7140, 1.8 }, stats: { +983 Agi, +1475 Sta, +368 Crit, +353 Mastery }, relics: { +53 ilevels, +51 ilevels, +52 ilevels }
Local Off Hand Fangs of the Devourer
ilevel: 906, weapon: { 3844 - 7140, 1.8 }, stats: { +983 Agi, +1475 Sta, +368 Crit, +353 Mastery }

Talents

Level
15 Master of Subtlety (Subtlety Rogue) Weaponmaster (Subtlety Rogue) Gloomblade (Subtlety Rogue)
30 Nightstalker Subterfuge Shadow Focus
45 Deeper Stratagem Anticipation Vigor
60 Soothing Darkness (Subtlety Rogue) Elusiveness Cheat Death
75 Strike from the Shadows (Subtlety Rogue) Prey on the Weak Tangled Shadow (Subtlety Rogue)
90 Premeditation (Subtlety Rogue) Alacrity Enveloping Shadows (Subtlety Rogue)
100 Master of Shadows (Subtlety Rogue) Marked for Death Death from Above

Profile

rogue="EEF+DoS"
origin="https://eu.api.battle.net/wow/character/dalaran/Esdeåth/advanced"
level=110
race=human
role=attack
position=back
professions=alchemy=800/enchanting=133
talents=1210011
artifact=17:0:0:0:0:851:1:852:3:853:3:854:3:855:3:856:3:857:3:858:3:859:3:860:3:861:1:862:1:863:1:864:1:865:1:866:1:1349:1:1386:14
spec=subtlety

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,name=flask_of_the_seventh_demon
actions.precombat+=/augmentation,name=defiled
actions.precombat+=/food,name=seedbattered_fish_plate
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/stealth
actions.precombat+=/potion,name=old_war
actions.precombat+=/marked_for_death,if=raid_event.adds.in>40
# Defined variables that doesn't change during the fight
actions.precombat+=/variable,name=ssw_refund,value=equipped.shadow_satyrs_walk*(4+ssw_refund_offset)
actions.precombat+=/variable,name=stealth_threshold,value=(15+talent.vigor.enabled*35+talent.master_of_shadows.enabled*30+variable.ssw_refund)
actions.precombat+=/enveloping_shadows,if=combo_points>=5
actions.precombat+=/symbols_of_death

# Executed every time the actor is available.
actions=call_action_list,name=cds
# Fully switch to the Stealthed Rotation (by doing so, it forces pooling if nothing is available)
actions+=/run_action_list,name=stealthed,if=stealthed.all
actions+=/call_action_list,name=finish,if=combo_points>=5|(combo_points>=4&spell_targets.shuriken_storm>=3&spell_targets.shuriken_storm<=4)
actions+=/call_action_list,name=stealth_als,if=combo_points.deficit>=2+talent.premeditation.enabled
actions+=/call_action_list,name=build,if=energy.deficit<=variable.stealth_threshold

# Builders
actions.build=shuriken_storm,if=spell_targets.shuriken_storm>=2
actions.build+=/gloomblade
actions.build+=/backstab

# Cooldowns
actions.cds=potion,name=old_war,if=buff.bloodlust.react|target.time_to_die<=25|buff.shadow_blades.up
actions.cds+=/use_item,slot=finger2,if=(buff.shadow_blades.up&stealthed.rogue)|target.time_to_die<20
actions.cds+=/use_item,slot=trinket2,if=(buff.shadow_blades.up&stealthed.rogue)|target.time_to_die<20
actions.cds+=/blood_fury,if=stealthed.rogue
actions.cds+=/berserking,if=stealthed.rogue
actions.cds+=/arcane_torrent,if=stealthed.rogue&energy.deficit>70
actions.cds+=/shadow_blades,if=combo_points<=2|(equipped.denial_of_the_halfgiants&combo_points>=1)
actions.cds+=/goremaws_bite,if=!stealthed.all&cooldown.shadow_dance.charges_fractional<=2.45&((combo_points.deficit>=4-(time<10)*2&energy.deficit>50+talent.vigor.enabled*25-(time>=10)*15)|target.time_to_die<8)
actions.cds+=/marked_for_death,target_if=min:target.time_to_die,if=target.time_to_die<combo_points.deficit|(raid_event.adds.in>40&combo_points.deficit>=4+talent.deeper_strategem.enabled+talent.anticipation.enabled)

# Finishers
actions.finish=enveloping_shadows,if=buff.enveloping_shadows.remains<target.time_to_die&buff.enveloping_shadows.remains<=combo_points*1.8
actions.finish+=/death_from_above,if=spell_targets.death_from_above>=6
actions.finish+=/nightblade,cycle_targets=1,if=target.time_to_die>8&((refreshable&(!finality|buff.finality_nightblade.up))|remains<tick_time)
actions.finish+=/death_from_above
actions.finish+=/eviscerate

# Stealth Action List Starter
actions.stealth_als=call_action_list,name=stealth_cds,if=energy.deficit<=variable.stealth_threshold&(!equipped.shadow_satyrs_walk|cooldown.shadow_dance.charges_fractional>=2.45|energy.deficit>=10)
actions.stealth_als+=/call_action_list,name=stealth_cds,if=spell_targets.shuriken_storm>=5
actions.stealth_als+=/call_action_list,name=stealth_cds,if=(cooldown.shadowmeld.up&!cooldown.vanish.up&cooldown.shadow_dance.charges<=1)
actions.stealth_als+=/call_action_list,name=stealth_cds,if=target.time_to_die<12*cooldown.shadow_dance.charges_fractional*(1+equipped.shadow_satyrs_walk*0.5)

# Stealth Cooldowns
actions.stealth_cds=shadow_dance,if=charges_fractional>=2.45
actions.stealth_cds+=/vanish
actions.stealth_cds+=/sprint_offensive
actions.stealth_cds+=/shadow_dance,if=charges>=2&combo_points<=1
actions.stealth_cds+=/pool_resource,for_next=1,extra_amount=40
actions.stealth_cds+=/shadowmeld,if=energy>=40&energy.deficit>=10+variable.ssw_refund
actions.stealth_cds+=/shadow_dance,if=combo_points<=1

# Stealthed Rotation
actions.stealthed=symbols_of_death,if=(buff.symbols_of_death.remains<target.time_to_die-4&buff.symbols_of_death.remains<=buff.symbols_of_death.duration*0.3)|equipped.shadow_satyrs_walk&energy.time_to_max<0.25
actions.stealthed+=/call_action_list,name=finish,if=combo_points>=5
actions.stealthed+=/shuriken_storm,if=buff.shadowmeld.down&((combo_points.deficit>=3&spell_targets.shuriken_storm>=2+talent.premeditation.enabled+equipped.shadow_satyrs_walk)|buff.the_dreadlords_deceit.stack>=29)
actions.stealthed+=/shadowstrike

head=cowl_of_fright,id=139205,bonus_id=1805/43/1507/3337
neck=sea_fan_pendant,id=142428,bonus_id=3507/1497,enchant=mark_of_the_hidden_satyr
shoulders=steelgazer_hide_mantle,id=134154,bonus_id=3417/43/1542/3337
back=drape_of_the_manastarved,id=141543,bonus_id=1808/1487/3337,gems=200agi,enchant=200agi
chest=biornskin_vest,id=134197,bonus_id=3417/1552/3337
shirt=common_gray_shirt,id=3428
wrists=denial_of_the_halfgiants,id=137100,bonus_id=3459/3458
hands=cruel_vice_grips,id=133617,bonus_id=3510/1537/3337
waist=strand_of_whelk_shells,id=142416,bonus_id=3507/1808/1497,gems=150mastery
legs=legwraps_of_unworthy_souls,id=133616,bonus_id=3418/1532/3337
feet=shadow_satyrs_walk,id=137032,bonus_id=3459/3458
finger1=grubby_silver_ring,id=139236,bonus_id=1806/1808/1502,gems=150vers,enchant=200mastery
finger2=ring_of_collapsing_futures,id=142173,bonus_id=40/3453/1482/3336,enchant=200vers
trinket1=entwined_elemental_foci,id=140796,bonus_id=3519
trinket2=draught_of_souls,id=140808,bonus_id=3519
main_hand=fangs_of_the_devourer,id=128476,bonus_id=743,gem_id=139267/142512/139253/0,relic_id=1806:1507:3336/3468:1492/1806:1502/0
off_hand=fangs_of_the_devourer,id=128479

# Gear Summary
# gear_ilvl=891.06
# gear_agility=18504
# gear_stamina=28183
# gear_crit_rating=5349
# gear_haste_rating=4736
# gear_mastery_rating=8343
# gear_versatility_rating=3832
# gear_avoidance_rating=419
# gear_armor=2297

Equipped : 553062 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
553062.5 553062.5 659.1 / 0.119% 92509.7 / 16.7% 19101.9
RPS Out RPS In Primary Resource Waiting APM Active Skill
28.8 28.8 Energy 23.05% 56.5 100.0% 100%
Origin https://eu.api.battle.net/wow/character/dalaran/Esdeåth/advanced
Talents
  • 15: Master of Subtlety (Subtlety Rogue)
  • 30: Subterfuge
  • 45: Deeper Stratagem
  • 90: Premeditation (Subtlety Rogue)
  • 100: Master of Shadows (Subtlety Rogue)
  • Talent Calculator
Artifact
Professions
  • alchemy: 800
  • enchanting: 133

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
Equipped 553062
auto_attack_mh 9966 1.8% 119.6 2.04sec 25331 15929 Direct 119.6 24221 48443 25332 23.6% 19.0%  

Stats details: auto_attack_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 119.59 119.59 0.00 0.00 1.5903 0.0000 3029437.38 4453559.91 31.98 15928.90 15928.90
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 68.73 57.47% 24220.62 18731 24725 24227.32 23523 24652 1664612 2447138 31.98
crit 28.17 23.56% 48442.88 37463 49451 48459.77 46454 49451 1364825 2006422 31.98
miss 22.69 18.97% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_mh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
auto_attack_oh 4942 0.9% 118.7 2.06sec 12661 7900 Direct 118.7 12111 24221 12661 23.6% 19.1%  

Stats details: auto_attack_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 118.68 118.68 0.00 0.00 1.6026 0.0000 1502581.02 2208936.43 31.98 7899.80 7899.80
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 67.99 57.28% 12110.97 9366 12363 12114.61 11793 12337 823383 1210451 31.98
crit 28.04 23.63% 24221.24 18731 24725 24227.98 23180 24725 679198 998486 31.98
miss 22.65 19.09% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_oh

Static Values
  • id:1
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Backstab 27911 5.1% 51.3 5.60sec 164682 163946 Direct 51.3 133262 266492 164679 23.6% 0.0%  

Stats details: backstab

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 51.26 51.26 0.00 0.00 1.0045 0.0000 8441726.50 12410137.58 31.98 163945.67 163945.67
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.17 76.42% 133262.28 103544 136678 133300.31 129610 136678 5220168 7674141 31.98
crit 12.09 23.58% 266491.65 207089 273357 266579.90 250347 273357 3221559 4735997 31.98
 
 

Action details: backstab

Static Values
  • id:53
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:53
  • name:Backstab
  • school:physical
  • tooltip:
  • description:Stab the target, causing ${$sw2*$<mult>} Physical damage. Damage increased by {$s4=30}% when you are behind your target. |cFFFFFFFFAwards {$s3=1} combo $lpoint:points;.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.70
 
Collapse 1614 0.3% 5.8 43.29sec 82052 0 Direct 5.8 66469 132902 82054 23.5% 0.0%  

Stats details: collapse

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.84 5.84 0.00 0.00 0.0000 0.0000 479444.48 479444.48 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.47 76.54% 66468.57 50574 66758 66108.12 0 66758 297279 297279 0.00
crit 1.37 23.46% 132902.20 101148 133516 97656.51 0 133516 182165 182165 0.00
 
 

Action details: collapse

Static Values
  • id:234142
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:15.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:234142
  • name:Collapse
  • school:shadow
  • tooltip:
  • description:Deal {$s1=40000} Shadow damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:40000.00
  • base_dd_max:40000.00
 
Eviscerate 178326 32.2% 53.2 5.63sec 1004859 1000371 Direct 53.2 724304 1449959 1004842 38.7% 0.0%  

Stats details: eviscerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 53.18 53.18 0.00 0.00 1.0045 0.0000 53434812.27 78554235.51 31.98 1000370.91 1000370.91
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 32.62 61.34% 724303.54 449540 882968 724692.46 664797 789212 23624980 34730959 31.98
crit 20.56 38.66% 1449959.15 899080 1765937 1450922.16 1310067 1644621 29809832 43823277 31.98
 
 

Action details: eviscerate

Static Values
  • id:196819
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.15
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:196819
  • name:Eviscerate
  • school:physical
  • tooltip:
  • description:Finishing move that disembowels the target, causing damage per combo point. 1 point : ${$m1*1} damage 2 points: ${$m1*2} damage 3 points: ${$m1*3} damage 4 points: ${$m1*4} damage 5 points: ${$m1*5} damage{$?s193531=false}[ 6 points: ${$m1*6} damage][]
Weapon
  • normalized:false
  • weapon_power_mod:0.000000
  • weapon_multiplier:0.00
 
Goremaw's Bite 0 (9675) 0.0% (1.8%) 4.7 63.56sec 624416 621691

Stats details: goremaws_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.67 0.00 0.00 0.00 1.0045 0.0000 0.00 0.00 0.00 621691.07 621691.07
 
 

Action details: goremaws_bite

Static Values
  • id:209782
  • school:shadow
  • resource:none
  • range:8.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!stealthed.all&cooldown.shadow_dance.charges_fractional<=2.45&((combo_points.deficit>=4-(time<10)*2&energy.deficit>50+talent.vigor.enabled*25-(time>=10)*15)|target.time_to_die<8)
Spelldata
  • id:209782
  • name:Goremaw's Bite
  • school:physical
  • tooltip:
  • description:Lashes out at the target, inflicting ${$209783sw2+$209784sw2} Shadow damage and reducing movement speed by {$209786s1=60}% for {$209786d=8 seconds}. Grants $220901o2 Energy over {$220901d=6 seconds}. |cFFFFFFFFAwards {$220901s1=3} combo $lpoint:points;.|r
 
    Goremaw's Bite (_mh) 6451 1.2% 4.7 63.56sec 416402 0 Direct 4.7 337638 675761 416407 23.3% 0.0%  

Stats details: goremaws_bite_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.67 4.67 0.00 0.00 0.0000 0.0000 1943988.80 1943988.80 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 3.58 76.71% 337637.95 263941 348402 337367.37 0 348402 1209124 1209124 0.00
crit 1.09 23.29% 675761.39 527882 696805 475056.86 0 696805 734864 734864 0.00
 
 

Action details: goremaws_bite_mh

Static Values
  • id:209783
  • school:shadow
  • resource:none
  • range:8.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:209783
  • name:Goremaw's Bite
  • school:shadow
  • tooltip:
  • description:{$@spelldesc209782=Lashes out at the target, inflicting ${$209783sw2+$209784sw2} Shadow damage and reducing movement speed by {$209786s1=60}% for {$209786d=8 seconds}. Grants $220901o2 Energy over {$220901d=6 seconds}. |cFFFFFFFFAwards {$220901s1=3} combo $lpoint:points;.|r}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:10.00
 
    Goremaw's Bite (_oh) 3224 0.6% 4.7 63.56sec 208014 0 Direct 4.7 168846 337769 208018 23.2% 0.0%  

Stats details: goremaws_bite_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.67 4.67 0.00 0.00 0.0000 0.0000 971120.64 971120.64 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 3.59 76.81% 168846.48 131977 174210 168536.97 0 174210 605511 605511 0.00
crit 1.08 23.19% 337769.36 263954 348419 238335.74 0 348419 365609 365609 0.00
 
 

Action details: goremaws_bite_oh

Static Values
  • id:209784
  • school:shadow
  • resource:none
  • range:8.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:209784
  • name:Goremaw's Bite
  • school:shadow
  • tooltip:
  • description:{$@spelldesc209782=Lashes out at the target, inflicting ${$209783sw2+$209784sw2} Shadow damage and reducing movement speed by {$209786s1=60}% for {$209786d=8 seconds}. Grants $220901o2 Energy over {$220901d=6 seconds}. |cFFFFFFFFAwards {$220901s1=3} combo $lpoint:points;.|r}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:10.00
 
Mark of the Hidden Satyr 8387 1.5% 16.3 18.13sec 154466 0 Direct 16.3 125163 250300 154461 23.4% 0.0%  

Stats details: mark_of_the_hidden_satyr

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.34 16.34 0.00 0.00 0.0000 0.0000 2523337.80 2523337.80 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 12.51 76.58% 125162.66 96255 127057 125188.81 116606 127057 1565854 1565854 0.00
crit 3.83 23.42% 250299.61 192510 254113 245143.13 0 254113 957484 957484 0.00
 
 

Action details: mark_of_the_hidden_satyr

Static Values
  • id:191259
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191259
  • name:Mark of the Hidden Satyr
  • school:fire
  • tooltip:
  • description:Deals fire damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:2.500000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Nightblade 124161 22.5% 17.1 17.50sec 2188920 2179125 Periodic 144.7 208975 417878 258437 23.7% 0.0% 96.0%

Stats details: nightblade

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.08 0.00 144.68 144.68 1.0045 2.0000 37391605.53 37391605.53 0.00 121985.50 2179124.98
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 110.4 76.32% 208974.80 142520 233283 209025.98 203210 214825 23076224 23076224 0.00
crit 34.3 23.68% 417877.74 285041 466566 417957.03 388519 446038 14315381 14315381 0.00
 
 

Action details: nightblade

Static Values
  • id:195452
  • school:shadow
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:25.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:target.time_to_die>8&((refreshable&(!finality|buff.finality_nightblade.up))|remains<tick_time)
Spelldata
  • id:195452
  • name:Nightblade
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec and snared by attacks.
  • description:Finishing move that infects the target with shadowy energy, dealing Shadow damage over time and causing attacks against the target to reduce movement speed by {$206760s1=30}% for {$206760d=8 seconds}. Lasts longer per combo point. 1 point : ${$m1*8/2} over 8 sec 2 points: ${$m1*10/2} over 10 sec 3 points: ${$m1*12/2} over 12 sec 4 points: ${$m1*14/2} over 14 sec 5 points: ${$m1*16/2} over 16 sec{$?s193531=false}[ 6 points: ${$m1*18/2} over 18 sec][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:1.380000
  • spell_power_mod.tick:0.000000
  • base_td:1.00
  • dot_duration:6.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Potion of the Old War 18461 3.3% 23.1 8.14sec 236395 0 Direct 23.1 191570 383358 236396 23.4% 0.0%  

Stats details: potion_of_the_old_war

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.08 23.08 0.00 0.00 0.0000 0.0000 5455374.65 8019917.48 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.68 76.63% 191569.76 146122 192882 191564.95 179893 192882 3387667 4980192 31.98
crit 5.39 23.37% 383357.90 292245 385763 381914.06 0 385763 2067707 3039726 31.86
 
 

Action details: potion_of_the_old_war

Static Values
  • id:188028
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188028
  • name:Potion of the Old War
  • school:physical
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:135920.00
  • base_dd_max:203880.00
 
Shadow Blades 0 (15012) 0.0% (2.7%) 2.1 180.21sec 2119072 0

Stats details: shadow_blades

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.10 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: shadow_blades

Static Values
  • id:121471
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:combo_points<=2|(equipped.denial_of_the_halfgiants&combo_points>=1)
Spelldata
  • id:121471
  • name:Shadow Blades
  • school:physical
  • tooltip:Autoattacks deal pure Shadow damage. Combo-point-generating attacks generate {$s2=1} additional combo point.
  • description:Draws upon surrounding shadows to empower your weapons, causing auto attacks to deal Shadow damage and abilities that generate combo points to generate 1 additional combo point. Lasts {$d=15 seconds}.
 
    Shadow Blade (_mh) 10004 1.8% 66.4 3.61sec 44574 30738 Direct 66.4 36073 72162 44573 23.6% 0.0%  

Stats details: shadow_blade_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 66.41 66.41 0.00 0.00 1.4501 0.0000 2960279.35 2960279.35 0.00 30737.95 30737.95
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 50.77 76.45% 36073.04 27537 36349 36070.93 35080 36349 1831435 1831435 0.00
crit 15.64 23.55% 72162.29 55074 72697 72160.36 68732 72697 1128845 1128845 0.00
 
 

Action details: shadow_blade_mh

Static Values
  • id:121473
  • school:shadow
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:121473
  • name:Shadow Blade
  • school:shadow
  • tooltip:
  • description:Strike with dark energy, dealing Shadow damage equal to {$s1=1}% weapon damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
    Shadow Blade Off-hand 5008 0.9% 66.4 3.61sec 22311 15386 Direct 66.4 18038 36074 22311 23.7% 0.0%  

Stats details: shadow_blade_offhand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 66.41 66.41 0.00 0.00 1.4501 0.0000 1481760.22 1481760.22 0.00 15385.80 15385.80
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 50.68 76.31% 18037.64 13768 18174 18036.62 17679 18174 914097 914097 0.00
crit 15.74 23.69% 36073.91 27537 36349 36070.37 34697 36349 567663 567663 0.00
 
 

Action details: shadow_blade_offhand

Static Values
  • id:121474
  • school:shadow
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:121474
  • name:Shadow Blade Off-hand
  • school:shadow
  • tooltip:
  • description:Strike with dark energy, dealing Shadow damage equal to {$s1=1}% weapon damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Shadow Nova 10499 1.9% 32.1 9.60sec 98090 0 Direct 32.1 79277 158557 98089 23.7% 0.0%  

Stats details: shadow_nova

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 32.12 32.12 0.00 0.00 0.0000 0.0000 3151079.46 3151079.46 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 24.50 76.27% 79277.23 66069 79283 79277.12 78402 79283 1942379 1942379 0.00
crit 7.62 23.73% 158557.05 132139 158567 158493.85 0 158567 1208700 1208700 0.00
 
 

Action details: shadow_nova

Static Values
  • id:197800
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:5.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:197800
  • name:Shadow Nova
  • school:shadow
  • tooltip:
  • description:Deals {$s1=0} Shadow damage to enemies with $A1 yards.
 
Shadowstrike 117133 (144109) 21.2% (26.0%) 104.5 2.89sec 413571 411719 Direct 104.5 252481 504978 336149 33.1% 0.0%  

Stats details: shadowstrike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 104.50 104.50 0.00 0.00 1.0045 0.0000 35125918.26 51638427.06 31.98 411718.90 411718.90
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 69.87 66.86% 252480.53 210415 252498 252480.85 250358 252498 17641009 25933955 31.98
crit 34.63 33.14% 504977.51 420830 504996 504976.49 499192 504996 17484909 25704472 31.98
 
 

Action details: shadowstrike

Static Values
  • id:185438
  • school:physical
  • resource:energy
  • range:15.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:185438
  • name:Shadowstrike
  • school:physical
  • tooltip:
  • description:Strike through the shadows, $?a231718[appearing behind your target and ][]dealing $sw2 Physical damage. |cFFFFFFFFAwards {$s3=1} combo $lpoint:points;.|r
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:8.50
 
    Soul Rip 26976 4.9% 103.9 2.87sec 77857 0 Direct 103.9 62925 125849 77858 23.7% 0.0%  

Stats details: soul_rip

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 103.92 103.92 0.00 0.00 0.0000 0.0000 8090568.09 8090568.09 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 79.26 76.27% 62924.64 62925 62925 62924.64 62925 62925 4987234 4987234 0.00
crit 24.66 23.73% 125849.28 125849 125849 125849.28 125849 125849 3103334 3103334 0.00
 
 

Action details: soul_rip

Static Values
  • id:220893
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:220893
  • name:Soul Rip
  • school:shadow
  • tooltip:
  • description:{$@spelldesc209835=After using Shadowstrike or Cheap Shot, Akaari's Soul appears $m1 sec later and Soul Rips your target, dealing {$220893s1=1} Shadow damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:1.500000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Simple Action Stats Execute Interval
Equipped
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Equipped
  • harmful:false
  • if_expr:
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Equipped
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Equipped
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Shadow Dance 26.2 11.51sec

Stats details: shadow_dance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 26.24 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: shadow_dance

Static Values
  • id:185313
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:charges_fractional>=2.45
Spelldata
  • id:185313
  • name:Shadow Dance
  • school:physical
  • tooltip:
  • description:Allows use of all Stealth abilities and grants all the combat benefits of Stealth for {$d=3 seconds}. Effect not broken from taking damage or attacking. {$?s14062=false}[Movement speed while active is increased by {$1784s3=0}% and damage dealt is increased by {$1784s4=0}%. ]?s108209[Abilities cost {$112942s1=75}% less while active. ][]{$?s31223=false}[Attacks from Shadow Dance and for {$31223s1=5} sec after deal {$31665s1=10}% more damage. ][]
 
Sprint 2.7 122.24sec

Stats details: sprint

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.74 0.00 86.75 0.00 0.0000 0.2500 0.00 0.00 0.00 0.00 0.00
 
 

Action details: sprint

Static Values
  • id:2983
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:2983
  • name:Sprint
  • school:physical
  • tooltip:Movement speed increased by $w1%.
  • description:Increases your movement speed by {$s1=70}% for {$d=8 seconds}. Usable while stealthed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:0.25
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Symbols of Death 13.2 24.01sec

Stats details: symbols_of_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.20 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: symbols_of_death

Static Values
  • id:212283
  • school:physical
  • resource:energy
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:10.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:212283
  • name:Symbols of Death
  • school:physical
  • tooltip:All damage done increased by {$s1=20}%.
  • description:Invoke ancient symbols of power, increasing all damage you deal by {$s1=20}% for {$d=35 seconds}, and causing your next Shadowstrike to critically strike. Unaffected by the global cooldown.
 
Vanish 2.8 122.13sec

Stats details: vanish

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.85 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: vanish

Static Values
  • id:1856
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:1856
  • name:Vanish
  • school:physical
  • tooltip:Improved stealth.
  • description:Allows you to vanish from sight, entering stealth while in combat. For the first {$11327d=3 seconds} after vanishing, damage and harmful effects received will not break stealth. Also breaks movement impairing effects.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 37.50% 0.0(0.0) 1.0

Buff details

  • buff initial source:Equipped
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Death 13.2 0.0 22.9sec 24.0sec 1.59% 12.46% 0.0(0.0) 0.2

Buff details

  • buff initial source:Equipped
  • cooldown name:buff_death
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • death_1:1.59%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:227151
  • name:Death
  • tooltip:Your next Shadowstrike will critically strike.
  • description:{$@spelldesc212283=Invoke ancient symbols of power, increasing all damage you deal by {$s1=20}% for {$d=35 seconds}, and causing your next Shadowstrike to critically strike. Unaffected by the global cooldown.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Faster Than Light Trigger 2.7 0.0 122.2sec 122.2sec 2.72% 2.72% 0.0(0.0) 2.7

Buff details

  • buff initial source:Equipped
  • cooldown name:buff_faster_than_light_trigger
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • faster_than_light_trigger_1:2.72%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:197270
  • name:Faster Than Light Trigger
  • tooltip:
  • description:
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
Finality: Eviscerate 26.8 0.0 11.3sec 11.3sec 48.92% 49.52% 0.0(0.0) 0.0

Buff details

  • buff initial source:Equipped
  • cooldown name:buff_finality_eviscerate
  • max_stacks:10
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.04

Stack Uptimes

  • finality_eviscerate_5:22.37%
  • finality_eviscerate_6:26.55%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:197496
  • name:Finality: Eviscerate
  • tooltip:Your next Eviscerate will do $w1% increased damage.
  • description:
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Finality: Nightblade 8.7 0.0 35.2sec 35.2sec 42.87% 40.80% 0.0(0.0) 0.0

Buff details

  • buff initial source:Equipped
  • cooldown name:buff_finality_nightblade
  • max_stacks:6
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.04

Stack Uptimes

  • finality_nightblade_5:17.91%
  • finality_nightblade_6:24.96%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:197498
  • name:Finality: Nightblade
  • tooltip:Your next Nightblade will do $w1% increased damage.
  • description:
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Goremaw's Bite 4.7 0.0 63.5sec 63.5sec 9.18% 9.18% 27.6(27.6) 4.6

Buff details

  • buff initial source:Equipped
  • cooldown name:buff_goremaws_bite
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • goremaws_bite_1:9.18%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:220901
  • name:Goremaw's Bite
  • tooltip:Generating {$s2=5} Energy every $t2 sec.
  • description:{$@spelldesc209782=Lashes out at the target, inflicting ${$209783sw2+$209784sw2} Shadow damage and reducing movement speed by {$209786s1=60}% for {$209786d=8 seconds}. Grants $220901o2 Energy over {$220901d=6 seconds}. |cFFFFFFFFAwards {$220901s1=3} combo $lpoint:points;.|r}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Master of Subtlety 36.9 1.4 8.2sec 7.9sec 34.61% 47.63% 1.4(1.4) 12.7

Buff details

  • buff initial source:Equipped
  • cooldown name:buff_master_of_subtlety
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • master_of_subtlety_1:34.61%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:31223
  • name:Master of Subtlety
  • tooltip:
  • description:Attacks made while stealthed and for {$s1=5} seconds after breaking stealth cause an additional {$31665s1=10}% damage.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Master of Subtlety (_aura) 36.9 1.4 8.2sec 8.0sec 48.47% 34.11% 1.4(1.4) 0.0

Buff details

  • buff initial source:Equipped
  • cooldown name:buff_master_of_subtlety_aura
  • max_stacks:1
  • duration:150.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • master_of_subtlety_aura_1:48.47%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:31223
  • name:Master of Subtlety
  • tooltip:
  • description:Attacks made while stealthed and for {$s1=5} seconds after breaking stealth cause an additional {$31665s1=10}% damage.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of the Old War 2.0 0.0 151.5sec 0.0sec 16.24% 16.24% 0.0(0.0) 2.0

Buff details

  • buff initial source:Equipped
  • cooldown name:buff_potion_of_the_old_war
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_the_old_war_1:16.24%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188028
  • name:Potion of the Old War
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Shadow Blades 2.1 0.0 180.2sec 180.2sec 34.61% 39.75% 0.0(0.0) 2.0

Buff details

  • buff initial source:Equipped
  • cooldown name:buff_shadow_blades
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • shadow_blades_1:34.61%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:121471
  • name:Shadow Blades
  • tooltip:Autoattacks deal pure Shadow damage. Combo-point-generating attacks generate {$s2=1} additional combo point.
  • description:Draws upon surrounding shadows to empower your weapons, causing auto attacks to deal Shadow damage and abilities that generate combo points to generate 1 additional combo point. Lasts {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Shadow Dance 26.2 0.0 11.5sec 11.5sec 43.44% 43.44% 0.0(0.0) 25.9

Buff details

  • buff initial source:Equipped
  • cooldown name:buff_shadow_dance
  • max_stacks:1
  • duration:5.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • shadow_dance_1:43.44%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:185313
  • name:Shadow Dance
  • tooltip:
  • description:Allows use of all Stealth abilities and grants all the combat benefits of Stealth for {$d=3 seconds}. Effect not broken from taking damage or attacking. {$?s14062=false}[Movement speed while active is increased by {$1784s3=0}% and damage dealt is increased by {$1784s4=0}%. ]?s108209[Abilities cost {$112942s1=75}% less while active. ][]{$?s31223=false}[Attacks from Shadow Dance and for {$31223s1=5} sec after deal {$31665s1=10}% more damage. ][]
  • max_stacks:0
  • duration:3.00
  • cooldown:1.00
  • default_chance:0.00%
Sprint 2.7 0.0 122.2sec 122.2sec 7.20% 7.20% 86.8(86.8) 2.7

Buff details

  • buff initial source:Equipped
  • cooldown name:buff_sprint
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • sprint_1:7.20%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2983
  • name:Sprint
  • tooltip:Movement speed increased by $w1%.
  • description:Increases your movement speed by {$s1=70}% for {$d=8 seconds}. Usable while stealthed.
  • max_stacks:0
  • duration:8.00
  • cooldown:120.00
  • default_chance:0.00%
Stealth 6.5 0.0 45.0sec 52.1sec 1.03% 1.03% 0.0(0.0) 0.0

Buff details

  • buff initial source:Equipped
  • cooldown name:buff_stealth
  • max_stacks:1
  • duration:150.00
  • cooldown:2.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stealth_1:1.03%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:1784
  • name:Stealth
  • tooltip:Stealthed.$?$w3!=0[ Movement speed increased by $w3%.][]$?$w4!=0[ Damage increased by $w4%.][]
  • description:Conceals you in the shadows until cancelled, allowing you to stalk enemies without being seen. {$?s14062=false}[Movement speed while stealthed is increased by {$s3=0}% and damage dealt is increased by {$s4=0}%.]?s108209[ Abilities cost {$112942s1=75}% less while stealthed. ][]{$?s31223=false}[ Attacks from Stealth and for {$31223s1=5} sec after deal {$31665s1=10}% more damage.][]
  • max_stacks:0
  • duration:-0.00
  • cooldown:2.00
  • default_chance:100.00%
Subterfuge 6.6 0.0 44.6sec 52.2sec 6.55% 6.55% 0.0(0.0) 6.5

Buff details

  • buff initial source:Equipped
  • cooldown name:buff_subterfuge
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • subterfuge_1:6.55%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:115192
  • name:Subterfuge
  • tooltip:Temporarily concealed in the shadows.
  • description:{$@spelldesc108208=Your abilities requiring Stealth can still be used for {$115192d=3 seconds} after Stealth breaks.$?c3[ Also increases the duration of Shadow Dance by ${$m2/1000} sec.][ Also causes Garrote to deal {$115192s2=125}% increased damage and have no cooldown when used from Stealth or {$115192d=3 seconds} after Stealth breaks.]}
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
Symbols of Death 1.2 12.0 186.1sec 24.0sec 99.79% 99.26% 12.0(12.0) 0.3

Buff details

  • buff initial source:Equipped
  • cooldown name:buff_symbols_of_death
  • max_stacks:1
  • duration:35.00
  • cooldown:10.00
  • default_chance:100.00%
  • default_value:1.20

Stack Uptimes

  • symbols_of_death_1:99.79%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:212283
  • name:Symbols of Death
  • tooltip:All damage done increased by {$s1=20}%.
  • description:Invoke ancient symbols of power, increasing all damage you deal by {$s1=20}% for {$d=35 seconds}, and causing your next Shadowstrike to critically strike. Unaffected by the global cooldown.
  • max_stacks:0
  • duration:35.00
  • cooldown:10.00
  • default_chance:0.00%
Temptation 1.9 4.0 177.3sec 43.4sec 36.74% 66.99% 0.0(0.0) 1.4

Buff details

  • buff initial source:Equipped
  • cooldown name:buff_temptation
  • max_stacks:10
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • temptation_1:9.68%
  • temptation_2:9.72%
  • temptation_3:9.43%
  • temptation_4:7.75%
  • temptation_5:0.18%
  • temptation_6:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:234143
  • name:Temptation
  • tooltip:Increased chance for your Ring of Collapsing Futures to incur a {$s1=5} min cooldown.
  • description:{$@spelldesc234142=Deal {$s1=40000} Shadow damage to an enemy.}
  • max_stacks:10
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Vanish 5.6 0.0 52.0sec 52.0sec 5.54% 5.54% 0.0(0.0) 5.5

Buff details

  • buff initial source:Equipped
  • cooldown name:buff_vanish
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • vanish_1:5.54%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:11327
  • name:Vanish
  • tooltip:Improved stealth.$?$w3!=0[ Movement speed increased by $w3%.][]$?$w4!=0[ Damage increased by $w4%.][]
  • description:
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Equipped
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Seventh Demon

Buff details

  • buff initial source:Equipped
  • cooldown name:buff_flask_of_the_seventh_demon
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:1300.00

Stack Uptimes

  • flask_of_the_seventh_demon_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188033
  • name:Flask of the Seventh Demon
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (seedbattered_fish_plate)

Buff details

  • buff initial source:Equipped
  • cooldown name:buff_seedbattered_fish_plate
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:versatility_rating
  • amount:375.00

Stack Uptimes

  • seedbattered_fish_plate_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225605
  • name:Well Fed
  • tooltip:Versatility increased by $w1.
  • description:Increases versatility by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
Equipped
backstab Energy 51.3 1794.0 35.0 35.0 4705.5
eviscerate Energy 53.2 1861.1 35.0 35.0 28710.8
eviscerate Combo Points 53.2 296.3 5.6 5.6 180340.0
nightblade Energy 17.1 427.0 25.0 25.0 87558.2
nightblade Combo Points 17.1 95.2 5.6 5.6 392866.8
shadowstrike Energy 104.5 4179.8 40.0 40.0 10339.3
symbols_of_death Energy 13.2 427.1 32.3 32.3 0.0
Resource Gains Type Count Total Average Overflow
backstab Combo Points 51.26 51.26 (13.00%) 1.00 0.00 0.00%
goremaws_bite Combo Points 4.67 13.86 (3.51%) 2.97 0.15 1.07%
shadowstrike Combo Points 104.50 208.99 (53.00%) 2.00 0.00 0.00%
energy_regen Energy 1186.23 3339.57 (38.70%) 2.82 91.34 2.66%
Shadow Techniques Combo Points 71.99 71.09 (18.03%) 0.99 15.27 17.68%
Master of Shadows Energy 37.35 789.28 (9.15%) 21.13 144.53 15.48%
Shadow Blades Combo Points 58.61 49.11 (12.46%) 0.84 9.49 16.20%
Energetic Stabbing Energy 26.16 654.09 (7.58%) 25.00 0.00 0.00%
Goremaw's Bite Energy 27.62 135.10 (1.57%) 4.89 2.99 2.16%
Relentless Strikes Energy 70.26 3083.57 (35.74%) 43.89 48.46 1.55%
Shadow Satyr's Walk Energy 104.50 626.97 (7.27%) 6.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Energy 28.64 28.84
Combo Points 1.31 1.30
Combat End Resource Mean Min Max
Energy 39.60 6.05 100.00
Combo Points 2.76 0.00 6.00

Benefits & Uptimes

Benefits %
Uptimes %
Energy Cap 1.5%

Statistics & Data Analysis

Fight Length
Sample Data Equipped Fight Length
Count 4999
Mean 301.28
Minimum 222.03
Maximum 381.32
Spread ( max - min ) 159.29
Range [ ( max - min ) / 2 * 100% ] 26.44%
DPS
Sample Data Equipped Damage Per Second
Count 4999
Mean 553062.47
Minimum 467199.91
Maximum 651180.12
Spread ( max - min ) 183980.21
Range [ ( max - min ) / 2 * 100% ] 16.63%
Standard Deviation 23776.6072
5th Percentile 515256.95
95th Percentile 592816.74
( 95th Percentile - 5th Percentile ) 77559.79
Mean Distribution
Standard Deviation 336.2856
95.00% Confidence Intervall ( 552403.36 - 553721.57 )
Normalized 95.00% Confidence Intervall ( 99.88% - 100.12% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 71
0.1% Error 7100
0.1 Scale Factor Error with Delta=300 4825957
0.05 Scale Factor Error with Delta=300 19303828
0.01 Scale Factor Error with Delta=300 482595686
Priority Target DPS
Sample Data Equipped Priority Target Damage Per Second
Count 4999
Mean 553062.47
Minimum 467199.91
Maximum 651180.12
Spread ( max - min ) 183980.21
Range [ ( max - min ) / 2 * 100% ] 16.63%
Standard Deviation 23776.6072
5th Percentile 515256.95
95th Percentile 592816.74
( 95th Percentile - 5th Percentile ) 77559.79
Mean Distribution
Standard Deviation 336.2856
95.00% Confidence Intervall ( 552403.36 - 553721.57 )
Normalized 95.00% Confidence Intervall ( 99.88% - 100.12% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 71
0.1% Error 7100
0.1 Scale Factor Error with Delta=300 4825957
0.05 Scale Factor Error with Delta=300 19303828
0.01 Scale Factor Error with Delta=300 482595686
DPS(e)
Sample Data Equipped Damage Per Second (Effective)
Count 4999
Mean 553062.47
Minimum 467199.91
Maximum 651180.12
Spread ( max - min ) 183980.21
Range [ ( max - min ) / 2 * 100% ] 16.63%
Damage
Sample Data Equipped Damage
Count 4999
Mean 165983034.45
Minimum 122750850.33
Maximum 212212097.83
Spread ( max - min ) 89461247.50
Range [ ( max - min ) / 2 * 100% ] 26.95%
DTPS
Sample Data Equipped Damage Taken Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Equipped Healing Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Equipped Healing Per Second (Effective)
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Equipped Heal
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Equipped Healing Taken Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Equipped Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data EquippedTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Equipped Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,name=flask_of_the_seventh_demon
1 0.00 augmentation,name=defiled
2 0.00 food,name=seedbattered_fish_plate
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 stealth
5 0.00 potion,name=old_war
6 0.00 marked_for_death,if=raid_event.adds.in>40
7 0.00 variable,name=ssw_refund,value=equipped.shadow_satyrs_walk*(4+ssw_refund_offset)
Defined variables that doesn't change during the fight
8 0.00 variable,name=stealth_threshold,value=(15+talent.vigor.enabled*35+talent.master_of_shadows.enabled*30+variable.ssw_refund)
9 0.00 enveloping_shadows,if=combo_points>=5
A 0.00 symbols_of_death
Default action list Executed every time the actor is available.
# count action,conditions
B 0.00 call_action_list,name=cds
C 0.00 run_action_list,name=stealthed,if=stealthed.all
Fully switch to the Stealthed Rotation (by doing so, it forces pooling if nothing is available)
D 0.00 call_action_list,name=finish,if=combo_points>=5|(combo_points>=4&spell_targets.shuriken_storm>=3&spell_targets.shuriken_storm<=4)
E 0.00 call_action_list,name=stealth_als,if=combo_points.deficit>=2+talent.premeditation.enabled
F 0.00 call_action_list,name=build,if=energy.deficit<=variable.stealth_threshold
actions.build Builders
# count action,conditions
0.00 shuriken_storm,if=spell_targets.shuriken_storm>=2
0.00 gloomblade
G 51.26 backstab
actions.cds Cooldowns
# count action,conditions
H 1.00 potion,name=old_war,if=buff.bloodlust.react|target.time_to_die<=25|buff.shadow_blades.up
I 5.84 use_item,slot=finger2,if=(buff.shadow_blades.up&stealthed.rogue)|target.time_to_die<20
0.00 blood_fury,if=stealthed.rogue
0.00 berserking,if=stealthed.rogue
0.00 arcane_torrent,if=stealthed.rogue&energy.deficit>70
J 2.10 shadow_blades,if=combo_points<=2|(equipped.denial_of_the_halfgiants&combo_points>=1)
K 4.67 goremaws_bite,if=!stealthed.all&cooldown.shadow_dance.charges_fractional<=2.45&((combo_points.deficit>=4-(time<10)*2&energy.deficit>50+talent.vigor.enabled*25-(time>=10)*15)|target.time_to_die<8)
0.00 marked_for_death,target_if=min:target.time_to_die,if=target.time_to_die<combo_points.deficit|(raid_event.adds.in>40&combo_points.deficit>=4+talent.deeper_strategem.enabled+talent.anticipation.enabled)
actions.finish Finishers
# count action,conditions
0.00 enveloping_shadows,if=buff.enveloping_shadows.remains<target.time_to_die&buff.enveloping_shadows.remains<=combo_points*1.8
0.00 death_from_above,if=spell_targets.death_from_above>=6
L 17.08 nightblade,cycle_targets=1,if=target.time_to_die>8&((refreshable&(!finality|buff.finality_nightblade.up))|remains<tick_time)
0.00 death_from_above
M 53.18 eviscerate
actions.stealth_cds Stealth Cooldowns
# count action,conditions
R 3.62 shadow_dance,if=charges_fractional>=2.45
S 2.85 vanish
T 2.74 sprint_offensive
U 4.60 shadow_dance,if=charges>=2&combo_points<=1
0.00 pool_resource,for_next=1,extra_amount=40
0.00 shadowmeld,if=energy>=40&energy.deficit>=10+variable.ssw_refund
V 18.02 shadow_dance,if=combo_points<=1
actions.stealthed Stealthed Rotation
# count action,conditions
W 12.20 symbols_of_death,if=(buff.symbols_of_death.remains<target.time_to_die-4&buff.symbols_of_death.remains<=buff.symbols_of_death.duration*0.3)|equipped.shadow_satyrs_walk&energy.time_to_max<0.25
X 0.00 call_action_list,name=finish,if=combo_points>=5
0.00 shuriken_storm,if=buff.shadowmeld.down&((combo_points.deficit>=3&spell_targets.shuriken_storm>=2+talent.premeditation.enabled+equipped.shadow_satyrs_walk)|buff.the_dreadlords_deceit.stack>=29)
Y 104.50 shadowstrike

Sample Sequence

0124578AJIYYLRYYMYMSYYMRWYYMYIYLKMGGMRWYYMYMGTGGMYYMRWYYLYYMGGMRYYMYMUYYMYGLGGMUYYYMYGMUYWYLVYYMYYMKGMVYYLYYMVYYYMGGMVYYWLYGMGGGGLVWYYMYSYMYGGMVWYYLYKMVYYMWYYMTGYYLVWYYYMGGGMGGGJHLVYYMYGMVYYLWYYMGGMVYYMYYMKGMVYYLYYMGGMVYYMYMGGLVWYYMYGMGGGLVYYMYYMSYYYLGGGMKGGMTVWYYYMYYMVYYLYYGMVYYM

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask Equipped 100.0/100: 100% energy | 0.0/6: 0% combo_points
Pre precombat 1 augmentation Equipped 100.0/100: 100% energy | 0.0/6: 0% combo_points
Pre precombat 2 food Equipped 100.0/100: 100% energy | 0.0/6: 0% combo_points
Pre precombat 4 stealth Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, stealth
Pre precombat 5 potion Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, stealth, potion_of_the_old_war
Pre precombat 7 ssw_refund Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, stealth, potion_of_the_old_war
Pre precombat 8 stealth_threshold Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, stealth, potion_of_the_old_war
Pre precombat A symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, stealth, symbols_of_death, death, potion_of_the_old_war
0:00.000 cds J shadow_blades Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, stealth, symbols_of_death, death, potion_of_the_old_war
0:00.000 cds I use_item_ring_of_collapsing_futures Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, stealth, symbols_of_death, shadow_blades, death, potion_of_the_old_war
0:00.000 stealthed Y shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points temptation, master_of_subtlety_aura, stealth, symbols_of_death, shadow_blades, death, potion_of_the_old_war
0:01.004 stealthed Y shadowstrike Fluffy_Pillow 80.3/100: 80% energy | 3.0/6: 50% combo_points bloodlust, temptation, master_of_subtlety_aura, stealth, subterfuge, symbols_of_death, shadow_blades, potion_of_the_old_war
0:02.007 finish L nightblade Fluffy_Pillow 60.6/100: 61% energy | 6.0/6: 100% combo_points bloodlust, temptation, master_of_subtlety_aura, stealth, subterfuge, symbols_of_death, shadow_blades, potion_of_the_old_war
0:03.011 stealth_cds R shadow_dance Fluffy_Pillow 89.9/100: 90% energy | 0.0/6: 0% combo_points bloodlust, temptation, master_of_subtlety, symbols_of_death, shadow_blades, finality_nightblade(6), potion_of_the_old_war
0:03.011 stealthed Y shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points bloodlust, temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6), potion_of_the_old_war
0:04.015 stealthed Y shadowstrike Fluffy_Pillow 80.3/100: 80% energy | 3.0/6: 50% combo_points bloodlust, temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6), potion_of_the_old_war
0:05.021 finish M eviscerate Fluffy_Pillow 60.6/100: 61% energy | 6.0/6: 100% combo_points bloodlust, temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6), potion_of_the_old_war
0:06.024 stealthed Y shadowstrike Fluffy_Pillow 79.9/100: 80% energy | 0.0/6: 0% combo_points bloodlust, temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6), potion_of_the_old_war
0:07.028 finish M eviscerate Fluffy_Pillow 60.2/100: 60% energy | 5.0/6: 83% combo_points bloodlust, temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6), potion_of_the_old_war
0:08.032 stealth_cds S vanish Fluffy_Pillow 79.5/100: 80% energy | 0.0/6: 0% combo_points bloodlust, temptation, master_of_subtlety, symbols_of_death, shadow_blades, finality_nightblade(6), potion_of_the_old_war
0:08.032 stealthed Y shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points bloodlust, temptation, master_of_subtlety_aura, vanish, symbols_of_death, shadow_blades, finality_nightblade(6), potion_of_the_old_war
0:09.036 stealthed Y shadowstrike Fluffy_Pillow 80.3/100: 80% energy | 3.0/6: 50% combo_points bloodlust, temptation, master_of_subtlety_aura, vanish, subterfuge, symbols_of_death, shadow_blades, finality_nightblade(6), potion_of_the_old_war
0:10.040 finish M eviscerate Fluffy_Pillow 85.6/100: 86% energy | 6.0/6: 100% combo_points bloodlust, temptation, master_of_subtlety_aura, vanish, subterfuge, symbols_of_death, shadow_blades, finality_nightblade(6), potion_of_the_old_war
0:11.044 stealth_cds R shadow_dance Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points bloodlust, temptation, master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6), potion_of_the_old_war
0:11.044 stealthed W symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points bloodlust, temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6), potion_of_the_old_war
0:11.044 stealthed Y shadowstrike Fluffy_Pillow 65.0/100: 65% energy | 0.0/6: 0% combo_points bloodlust, temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, death, finality_eviscerate(6), finality_nightblade(6), potion_of_the_old_war
0:12.049 stealthed Y shadowstrike Fluffy_Pillow 45.3/100: 45% energy | 4.0/6: 67% combo_points bloodlust, temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6), potion_of_the_old_war
0:13.054 finish M eviscerate Fluffy_Pillow 50.6/100: 51% energy | 6.0/6: 100% combo_points bloodlust, temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6), potion_of_the_old_war
0:14.060 stealthed Y shadowstrike Fluffy_Pillow 70.0/100: 70% energy | 0.0/6: 0% combo_points bloodlust, temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6), potion_of_the_old_war
0:15.063 cds I use_item_ring_of_collapsing_futures Fluffy_Pillow 50.2/100: 50% energy | 4.0/6: 67% combo_points bloodlust, temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6), potion_of_the_old_war
0:15.063 stealthed Y shadowstrike Fluffy_Pillow 50.2/100: 50% energy | 4.0/6: 67% combo_points bloodlust, temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6), potion_of_the_old_war
0:16.066 finish L nightblade Fluffy_Pillow 30.5/100: 31% energy | 6.0/6: 100% combo_points bloodlust, temptation(2), master_of_subtlety, symbols_of_death, shadow_blades, finality_nightblade(6), potion_of_the_old_war
0:17.070 cds K goremaws_bite Fluffy_Pillow 59.8/100: 60% energy | 2.0/6: 33% combo_points bloodlust, temptation(2), master_of_subtlety, symbols_of_death, shadow_blades, potion_of_the_old_war
0:18.075 finish M eviscerate Fluffy_Pillow 79.1/100: 79% energy | 5.0/6: 83% combo_points bloodlust, temptation(2), master_of_subtlety, symbols_of_death, shadow_blades, goremaws_bite, potion_of_the_old_war
0:19.080 build G backstab Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points bloodlust, temptation(2), master_of_subtlety, symbols_of_death, shadow_blades, goremaws_bite, finality_eviscerate(5), potion_of_the_old_war
0:20.085 build G backstab Fluffy_Pillow 84.3/100: 84% energy | 4.0/6: 67% combo_points bloodlust, temptation(2), master_of_subtlety, symbols_of_death, shadow_blades, goremaws_bite, finality_eviscerate(5), potion_of_the_old_war
0:21.089 finish M eviscerate Fluffy_Pillow 68.6/100: 69% energy | 6.0/6: 100% combo_points bloodlust, temptation(2), symbols_of_death, shadow_blades, goremaws_bite, finality_eviscerate(5), potion_of_the_old_war
0:22.095 stealth_cds R shadow_dance Fluffy_Pillow 92.9/100: 93% energy | 1.0/6: 17% combo_points bloodlust, temptation(2), symbols_of_death, shadow_blades, goremaws_bite, potion_of_the_old_war
0:22.095 stealthed W symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points bloodlust, temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, goremaws_bite, potion_of_the_old_war
0:22.095 stealthed Y shadowstrike Fluffy_Pillow 65.0/100: 65% energy | 1.0/6: 17% combo_points bloodlust, temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, goremaws_bite, death, potion_of_the_old_war
0:23.100 stealthed Y shadowstrike Fluffy_Pillow 75.3/100: 75% energy | 4.0/6: 67% combo_points bloodlust, temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades
0:24.105 finish M eviscerate Fluffy_Pillow 80.6/100: 81% energy | 6.0/6: 100% combo_points bloodlust, temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades
0:25.109 stealthed Y shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points bloodlust, temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6)
0:26.114 finish M eviscerate Fluffy_Pillow 100.0/100: 100% energy | 5.0/6: 83% combo_points bloodlust, temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6)
0:27.119 build G backstab Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points bloodlust, temptation(2), master_of_subtlety, symbols_of_death, shadow_blades
0:28.123 stealth_cds T sprint Fluffy_Pillow 79.3/100: 79% energy | 2.0/6: 33% combo_points bloodlust, temptation(2), master_of_subtlety, symbols_of_death, shadow_blades
0:28.123 build G backstab Fluffy_Pillow 79.3/100: 79% energy | 2.0/6: 33% combo_points bloodlust, temptation(2), master_of_subtlety, sprint, symbols_of_death, shadow_blades, faster_than_light_trigger
0:29.129 build G backstab Fluffy_Pillow 58.6/100: 59% energy | 4.0/6: 67% combo_points bloodlust, temptation(2), master_of_subtlety, sprint, symbols_of_death, shadow_blades, faster_than_light_trigger
0:30.134 finish M eviscerate Fluffy_Pillow 37.9/100: 38% energy | 6.0/6: 100% combo_points bloodlust, temptation(2), master_of_subtlety, sprint, symbols_of_death, shadow_blades, faster_than_light_trigger
0:31.137 stealthed Y shadowstrike Fluffy_Pillow 82.2/100: 82% energy | 1.0/6: 17% combo_points bloodlust, temptation(2), master_of_subtlety_aura, vanish, subterfuge, sprint, symbols_of_death, shadow_blades, finality_eviscerate(6)
0:32.143 stealthed Y shadowstrike Fluffy_Pillow 62.5/100: 63% energy | 4.0/6: 67% combo_points bloodlust, temptation(2), master_of_subtlety_aura, vanish, subterfuge, sprint, symbols_of_death, shadow_blades, finality_eviscerate(6)
0:33.147 finish M eviscerate Fluffy_Pillow 42.8/100: 43% energy | 6.0/6: 100% combo_points bloodlust, temptation(2), master_of_subtlety_aura, vanish, subterfuge, sprint, symbols_of_death, shadow_blades, finality_eviscerate(6)
0:34.153 stealth_cds R shadow_dance Fluffy_Pillow 87.2/100: 87% energy | 1.0/6: 17% combo_points bloodlust, temptation(2), master_of_subtlety, sprint, symbols_of_death, shadow_blades
0:34.153 stealthed W symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points bloodlust, temptation(2), master_of_subtlety_aura, shadow_dance, sprint, symbols_of_death, shadow_blades
0:34.153 stealthed Y shadowstrike Fluffy_Pillow 65.0/100: 65% energy | 1.0/6: 17% combo_points bloodlust, temptation(2), master_of_subtlety_aura, shadow_dance, sprint, symbols_of_death, shadow_blades, death
0:35.158 stealthed Y shadowstrike Fluffy_Pillow 45.3/100: 45% energy | 4.0/6: 67% combo_points bloodlust, temptation(2), master_of_subtlety_aura, shadow_dance, sprint, symbols_of_death, shadow_blades
0:36.164 finish L nightblade Fluffy_Pillow 25.6/100: 26% energy | 6.0/6: 100% combo_points bloodlust, temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades
0:37.169 stealthed Y shadowstrike Fluffy_Pillow 55.0/100: 55% energy | 0.0/6: 0% combo_points bloodlust, temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6)
0:38.172 stealthed Y shadowstrike Fluffy_Pillow 60.2/100: 60% energy | 4.0/6: 67% combo_points bloodlust, temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6)
0:39.177 finish M eviscerate Fluffy_Pillow 65.5/100: 66% energy | 6.0/6: 100% combo_points bloodlust, temptation(2), master_of_subtlety, symbols_of_death, shadow_blades, finality_nightblade(6)
0:40.181 build G backstab Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points bloodlust, temptation(2), master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6)
0:41.186 build G backstab Fluffy_Pillow 76.0/100: 76% energy | 3.0/6: 50% combo_points temptation(2), master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6)
0:42.190 finish M eviscerate Fluffy_Pillow 52.0/100: 52% energy | 5.0/6: 83% combo_points temptation(2), master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6)
0:43.196 stealth_cds R shadow_dance Fluffy_Pillow 68.0/100: 68% energy | 1.0/6: 17% combo_points temptation(2), master_of_subtlety, symbols_of_death, shadow_blades, finality_nightblade(6)
0:43.196 stealthed Y shadowstrike Fluffy_Pillow 93.0/100: 93% energy | 1.0/6: 17% combo_points temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6)
0:44.201 stealthed Y shadowstrike Fluffy_Pillow 70.0/100: 70% energy | 4.0/6: 67% combo_points temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6)
0:45.205 finish M eviscerate Fluffy_Pillow 47.0/100: 47% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6)
0:46.210 stealthed Y shadowstrike Fluffy_Pillow 63.0/100: 63% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6)
0:47.214 finish M eviscerate Fluffy_Pillow 40.0/100: 40% energy | 5.0/6: 83% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6)
0:48.218 stealth_cds U shadow_dance Fluffy_Pillow 56.0/100: 56% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_nightblade(6)
0:48.218 stealthed Y shadowstrike Fluffy_Pillow 81.0/100: 81% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6)
0:49.222 stealthed Y shadowstrike Fluffy_Pillow 58.0/100: 58% energy | 3.0/6: 50% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6)
0:50.228 finish M eviscerate Fluffy_Pillow 35.1/100: 35% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6)
0:51.232 stealthed Y shadowstrike Fluffy_Pillow 51.1/100: 51% energy | 1.0/6: 17% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6)
0:52.238 Waiting     2.100 sec 28.1/100: 28% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6)
0:54.338 build G backstab Fluffy_Pillow 51.1/100: 51% energy | 4.0/6: 67% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6)
0:55.343 finish L nightblade Fluffy_Pillow 27.1/100: 27% energy | 6.0/6: 100% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6)
0:56.349 build G backstab Fluffy_Pillow 93.1/100: 93% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6)
0:57.352 build G backstab Fluffy_Pillow 69.1/100: 69% energy | 2.0/6: 33% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6)
0:58.356 finish M eviscerate Fluffy_Pillow 45.1/100: 45% energy | 5.0/6: 83% combo_points symbols_of_death, finality_eviscerate(6)
0:59.360 stealth_cds U shadow_dance Fluffy_Pillow 61.1/100: 61% energy | 0.0/6: 0% combo_points symbols_of_death
0:59.360 stealthed Y shadowstrike Fluffy_Pillow 86.1/100: 86% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
1:00.364 stealthed Y shadowstrike Fluffy_Pillow 88.1/100: 88% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
1:01.368 stealthed Y shadowstrike Fluffy_Pillow 65.1/100: 65% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
1:02.372 finish M eviscerate Fluffy_Pillow 42.1/100: 42% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
1:03.378 stealthed Y shadowstrike Fluffy_Pillow 58.1/100: 58% energy | 1.0/6: 17% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6)
1:04.383 Waiting     1.500 sec 35.1/100: 35% energy | 3.0/6: 50% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(6)
1:05.883 build G backstab Fluffy_Pillow 51.6/100: 52% energy | 3.0/6: 50% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(6)
1:06.887 Waiting     0.700 sec 27.6/100: 28% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(6)
1:07.587 finish M eviscerate Fluffy_Pillow 35.2/100: 35% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(6)
1:08.592 stealth_cds U shadow_dance Fluffy_Pillow 51.2/100: 51% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death
1:08.592 stealthed Y shadowstrike Fluffy_Pillow 76.2/100: 76% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
1:09.598 stealthed W symbols_of_death Fluffy_Pillow 53.3/100: 53% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
1:09.598 Waiting     2.015 sec 18.3/100: 18% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, death
1:11.613 stealthed Y shadowstrike Fluffy_Pillow 40.3/100: 40% energy | 3.0/6: 50% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, death
1:12.619 Waiting     0.797 sec 17.4/100: 17% energy | 5.0/6: 83% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
1:13.416 finish L nightblade Fluffy_Pillow 26.1/100: 26% energy | 5.0/6: 83% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
1:14.422 stealth_cds V shadow_dance Fluffy_Pillow 52.1/100: 52% energy | 1.0/6: 17% combo_points master_of_subtlety, symbols_of_death, finality_nightblade(5)
1:14.422 stealthed Y shadowstrike Fluffy_Pillow 77.1/100: 77% energy | 1.0/6: 17% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(5)
1:15.427 stealthed Y shadowstrike Fluffy_Pillow 79.1/100: 79% energy | 3.0/6: 50% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(5)
1:16.431 finish M eviscerate Fluffy_Pillow 56.1/100: 56% energy | 5.0/6: 83% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(5)
1:17.435 stealthed Y shadowstrike Fluffy_Pillow 72.1/100: 72% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5), finality_nightblade(5)
1:18.438 stealthed Y shadowstrike Fluffy_Pillow 49.1/100: 49% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5), finality_nightblade(5)
1:19.443 Waiting     0.900 sec 26.1/100: 26% energy | 6.0/6: 100% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5), finality_nightblade(5)
1:20.343 finish M eviscerate Fluffy_Pillow 36.0/100: 36% energy | 6.0/6: 100% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5), finality_nightblade(5)
1:21.347 cds K goremaws_bite Fluffy_Pillow 52.0/100: 52% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, finality_nightblade(5)
1:22.349 build G backstab Fluffy_Pillow 67.9/100: 68% energy | 3.0/6: 50% combo_points master_of_subtlety, symbols_of_death, goremaws_bite, finality_nightblade(5)
1:23.352 finish M eviscerate Fluffy_Pillow 48.9/100: 49% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death, goremaws_bite, finality_nightblade(5)
1:24.357 stealth_cds V shadow_dance Fluffy_Pillow 69.9/100: 70% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, goremaws_bite, finality_eviscerate(5), finality_nightblade(5)
1:24.357 stealthed Y shadowstrike Fluffy_Pillow 94.9/100: 95% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, goremaws_bite, finality_eviscerate(5), finality_nightblade(5)
1:25.360 stealthed Y shadowstrike Fluffy_Pillow 76.9/100: 77% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, goremaws_bite, finality_eviscerate(5), finality_nightblade(5)
1:26.363 finish L nightblade Fluffy_Pillow 58.9/100: 59% energy | 5.0/6: 83% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, goremaws_bite, finality_eviscerate(5), finality_nightblade(5)
1:27.366 stealthed Y shadowstrike Fluffy_Pillow 89.9/100: 90% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5)
1:28.371 stealthed Y shadowstrike Fluffy_Pillow 66.9/100: 67% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5)
1:29.376 finish M eviscerate Fluffy_Pillow 43.9/100: 44% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5)
1:30.381 stealth_cds V shadow_dance Fluffy_Pillow 59.9/100: 60% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death
1:30.381 stealthed Y shadowstrike Fluffy_Pillow 84.9/100: 85% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
1:31.385 stealthed Y shadowstrike Fluffy_Pillow 61.9/100: 62% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
1:32.390 Waiting     0.100 sec 38.9/100: 39% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
1:32.490 stealthed Y shadowstrike Fluffy_Pillow 40.0/100: 40% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
1:33.494 Waiting     1.726 sec 17.0/100: 17% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
1:35.220 finish M eviscerate Fluffy_Pillow 35.9/100: 36% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
1:36.224 build G backstab Fluffy_Pillow 51.9/100: 52% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(6)
1:37.228 Waiting     2.200 sec 27.9/100: 28% energy | 1.0/6: 17% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(6)
1:39.428 build G backstab Fluffy_Pillow 52.0/100: 52% energy | 3.0/6: 50% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(6)
1:40.433 Waiting     1.700 sec 28.1/100: 28% energy | 4.0/6: 67% combo_points symbols_of_death, finality_eviscerate(6)
1:42.133 finish M eviscerate Fluffy_Pillow 46.7/100: 47% energy | 5.0/6: 83% combo_points symbols_of_death, finality_eviscerate(6)
1:43.138 stealth_cds V shadow_dance Fluffy_Pillow 62.7/100: 63% energy | 0.0/6: 0% combo_points symbols_of_death
1:43.138 stealthed Y shadowstrike Fluffy_Pillow 87.7/100: 88% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
1:44.141 stealthed Y shadowstrike Fluffy_Pillow 64.7/100: 65% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
1:45.145 stealthed W symbols_of_death Fluffy_Pillow 41.7/100: 42% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
1:45.145 Waiting     1.872 sec 6.7/100: 7% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, death
1:47.017 finish L nightblade Fluffy_Pillow 27.2/100: 27% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, death
1:48.024 stealthed Y shadowstrike Fluffy_Pillow 53.2/100: 53% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, death, finality_nightblade(6)
1:49.031 Waiting     1.900 sec 30.2/100: 30% energy | 2.0/6: 33% combo_points master_of_subtlety, symbols_of_death, finality_nightblade(6)
1:50.931 build G backstab Fluffy_Pillow 51.1/100: 51% energy | 3.0/6: 50% combo_points master_of_subtlety, symbols_of_death, finality_nightblade(6)
1:51.936 Waiting     1.700 sec 27.1/100: 27% energy | 4.0/6: 67% combo_points master_of_subtlety, symbols_of_death, finality_nightblade(6)
1:53.636 finish M eviscerate Fluffy_Pillow 45.7/100: 46% energy | 5.0/6: 83% combo_points symbols_of_death, finality_nightblade(6)
1:54.639 build G backstab Fluffy_Pillow 61.7/100: 62% energy | 0.0/6: 0% combo_points symbols_of_death, finality_eviscerate(5), finality_nightblade(6)
1:55.644 Waiting     1.300 sec 37.7/100: 38% energy | 1.0/6: 17% combo_points symbols_of_death, finality_eviscerate(5), finality_nightblade(6)
1:56.944 build G backstab Fluffy_Pillow 51.9/100: 52% energy | 1.0/6: 17% combo_points symbols_of_death, finality_eviscerate(5), finality_nightblade(6)
1:57.949 Waiting     2.200 sec 27.9/100: 28% energy | 2.0/6: 33% combo_points symbols_of_death, finality_eviscerate(5), finality_nightblade(6)
2:00.149 build G backstab Fluffy_Pillow 52.0/100: 52% energy | 2.0/6: 33% combo_points symbols_of_death, finality_eviscerate(5), finality_nightblade(6)
2:01.154 Waiting     2.100 sec 28.1/100: 28% energy | 4.0/6: 67% combo_points symbols_of_death, finality_eviscerate(5), finality_nightblade(6)
2:03.254 build G backstab Fluffy_Pillow 51.1/100: 51% energy | 4.0/6: 67% combo_points symbols_of_death, finality_eviscerate(5), finality_nightblade(6)
2:04.258 finish L nightblade Fluffy_Pillow 27.1/100: 27% energy | 6.0/6: 100% combo_points symbols_of_death, finality_eviscerate(5), finality_nightblade(6)
2:05.262 stealth_cds V shadow_dance Fluffy_Pillow 93.1/100: 93% energy | 0.0/6: 0% combo_points symbols_of_death, finality_eviscerate(5)
2:05.262 stealthed W symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5)
2:05.262 stealthed Y shadowstrike Fluffy_Pillow 65.0/100: 65% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, death, finality_eviscerate(5)
2:06.267 stealthed Y shadowstrike Fluffy_Pillow 42.0/100: 42% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5)
2:07.272 Waiting     1.545 sec 19.0/100: 19% energy | 5.0/6: 83% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5)
2:08.817 finish M eviscerate Fluffy_Pillow 35.9/100: 36% energy | 5.0/6: 83% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5)
2:09.821 stealthed Y shadowstrike Fluffy_Pillow 51.9/100: 52% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
2:10.826 stealth_cds S vanish Fluffy_Pillow 54.0/100: 54% energy | 2.0/6: 33% combo_points master_of_subtlety, symbols_of_death
2:10.826 stealthed Y shadowstrike Fluffy_Pillow 79.0/100: 79% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, vanish, symbols_of_death
2:11.831 finish M eviscerate Fluffy_Pillow 56.0/100: 56% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, vanish, subterfuge, symbols_of_death
2:12.834 stealthed Y shadowstrike Fluffy_Pillow 72.0/100: 72% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, vanish, subterfuge, symbols_of_death, finality_eviscerate(6)
2:13.840 build G backstab Fluffy_Pillow 74.0/100: 74% energy | 2.0/6: 33% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(6)
2:14.843 Waiting     0.100 sec 50.0/100: 50% energy | 3.0/6: 50% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(6)
2:14.943 build G backstab Fluffy_Pillow 51.1/100: 51% energy | 3.0/6: 50% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(6)
2:15.948 Waiting     0.800 sec 27.1/100: 27% energy | 6.0/6: 100% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(6)
2:16.748 finish M eviscerate Fluffy_Pillow 35.8/100: 36% energy | 6.0/6: 100% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(6)
2:17.753 stealth_cds V shadow_dance Fluffy_Pillow 91.8/100: 92% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death
2:17.753 stealthed W symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
2:17.753 stealthed Y shadowstrike Fluffy_Pillow 65.0/100: 65% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, death
2:18.758 stealthed Y shadowstrike Fluffy_Pillow 42.0/100: 42% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
2:19.762 Waiting     1.346 sec 19.0/100: 19% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
2:21.108 finish L nightblade Fluffy_Pillow 33.8/100: 34% energy | 5.0/6: 83% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
2:22.113 stealthed Y shadowstrike Fluffy_Pillow 59.8/100: 60% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(5)
2:23.118 cds K goremaws_bite Fluffy_Pillow 36.8/100: 37% energy | 2.0/6: 33% combo_points master_of_subtlety, symbols_of_death, finality_nightblade(5)
2:24.121 finish M eviscerate Fluffy_Pillow 52.8/100: 53% energy | 6.0/6: 100% combo_points master_of_subtlety, symbols_of_death, goremaws_bite, finality_nightblade(5)
2:25.126 stealth_cds V shadow_dance Fluffy_Pillow 73.8/100: 74% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, goremaws_bite, finality_eviscerate(6), finality_nightblade(5)
2:25.197 stealthed Y shadowstrike Fluffy_Pillow 99.5/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, goremaws_bite, finality_eviscerate(6), finality_nightblade(5)
2:26.202 stealthed Y shadowstrike Fluffy_Pillow 81.6/100: 82% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, goremaws_bite, finality_eviscerate(6), finality_nightblade(5)
2:27.205 finish M eviscerate Fluffy_Pillow 63.5/100: 64% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, goremaws_bite, finality_eviscerate(6), finality_nightblade(5)
2:28.209 stealthed W symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, goremaws_bite, finality_nightblade(5)
2:28.209 stealthed Y shadowstrike Fluffy_Pillow 65.0/100: 65% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, goremaws_bite, death, finality_nightblade(5)
2:29.214 stealthed Y shadowstrike Fluffy_Pillow 47.0/100: 47% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(5)
2:30.218 Waiting     1.200 sec 24.0/100: 24% energy | 4.0/6: 67% combo_points master_of_subtlety, symbols_of_death, finality_nightblade(5)
2:31.418 finish M eviscerate Fluffy_Pillow 37.2/100: 37% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death, finality_nightblade(5)
2:32.423 stealth_cds T sprint Fluffy_Pillow 53.2/100: 53% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5), finality_nightblade(5)
2:32.423 build G backstab Fluffy_Pillow 53.2/100: 53% energy | 0.0/6: 0% combo_points master_of_subtlety, sprint, symbols_of_death, finality_eviscerate(5), finality_nightblade(5), faster_than_light_trigger
2:33.427 Waiting     2.000 sec 29.2/100: 29% energy | 1.0/6: 17% combo_points master_of_subtlety, sprint, symbols_of_death, finality_eviscerate(5), finality_nightblade(5), faster_than_light_trigger
2:35.427 stealthed Y shadowstrike Fluffy_Pillow 76.1/100: 76% energy | 1.0/6: 17% combo_points master_of_subtlety_aura, vanish, subterfuge, sprint, symbols_of_death, finality_eviscerate(5), finality_nightblade(5)
2:36.434 stealthed Y shadowstrike Fluffy_Pillow 53.1/100: 53% energy | 3.0/6: 50% combo_points master_of_subtlety_aura, vanish, subterfuge, sprint, symbols_of_death, finality_eviscerate(5), finality_nightblade(5)
2:37.440 finish L nightblade Fluffy_Pillow 55.1/100: 55% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, vanish, subterfuge, sprint, symbols_of_death, finality_eviscerate(5), finality_nightblade(5)
2:38.445 stealth_cds V shadow_dance Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety, sprint, symbols_of_death, finality_eviscerate(5)
2:38.445 stealthed W symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, sprint, symbols_of_death, finality_eviscerate(5)
2:38.445 stealthed Y shadowstrike Fluffy_Pillow 65.0/100: 65% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, sprint, symbols_of_death, death, finality_eviscerate(5)
2:39.449 stealthed Y shadowstrike Fluffy_Pillow 42.0/100: 42% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, sprint, symbols_of_death, finality_eviscerate(5)
2:40.453 stealthed Y shadowstrike Fluffy_Pillow 44.0/100: 44% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5)
2:41.458 Waiting     1.364 sec 21.0/100: 21% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5)
2:42.822 finish M eviscerate Fluffy_Pillow 35.9/100: 36% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5)
2:43.826 build G backstab Fluffy_Pillow 51.9/100: 52% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death
2:44.831 Waiting     2.200 sec 28.0/100: 28% energy | 1.0/6: 17% combo_points master_of_subtlety, symbols_of_death
2:47.031 build G backstab Fluffy_Pillow 52.1/100: 52% energy | 2.0/6: 33% combo_points master_of_subtlety, symbols_of_death
2:48.037 Waiting     2.100 sec 28.1/100: 28% energy | 3.0/6: 50% combo_points master_of_subtlety, symbols_of_death
2:50.137 build G backstab Fluffy_Pillow 51.1/100: 51% energy | 4.0/6: 67% combo_points symbols_of_death
2:51.142 Waiting     0.800 sec 27.1/100: 27% energy | 5.0/6: 83% combo_points symbols_of_death
2:51.942 finish M eviscerate Fluffy_Pillow 35.9/100: 36% energy | 5.0/6: 83% combo_points symbols_of_death
2:52.946 build G backstab Fluffy_Pillow 51.9/100: 52% energy | 0.0/6: 0% combo_points symbols_of_death, finality_eviscerate(5)
2:53.950 Waiting     2.200 sec 27.9/100: 28% energy | 1.0/6: 17% combo_points symbols_of_death, finality_eviscerate(5)
2:56.150 build G backstab Fluffy_Pillow 52.0/100: 52% energy | 2.0/6: 33% combo_points symbols_of_death, finality_eviscerate(5)
2:57.155 Waiting     2.200 sec 28.0/100: 28% energy | 3.0/6: 50% combo_points symbols_of_death, finality_eviscerate(5)
2:59.355 build G backstab Fluffy_Pillow 52.1/100: 52% energy | 3.0/6: 50% combo_points symbols_of_death, finality_eviscerate(5)
3:00.360 cds J shadow_blades Fluffy_Pillow 28.1/100: 28% energy | 5.0/6: 83% combo_points symbols_of_death, finality_eviscerate(5)
3:00.360 cds H potion Fluffy_Pillow 28.1/100: 28% energy | 5.0/6: 83% combo_points symbols_of_death, shadow_blades, finality_eviscerate(5)
3:00.360 finish L nightblade Fluffy_Pillow 28.1/100: 28% energy | 5.0/6: 83% combo_points symbols_of_death, shadow_blades, finality_eviscerate(5), potion_of_the_old_war
3:01.366 stealth_cds V shadow_dance Fluffy_Pillow 54.1/100: 54% energy | 0.0/6: 0% combo_points symbols_of_death, shadow_blades, finality_eviscerate(5), finality_nightblade(5), potion_of_the_old_war
3:01.366 stealthed Y shadowstrike Fluffy_Pillow 79.1/100: 79% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(5), finality_nightblade(5), potion_of_the_old_war
3:02.369 stealthed Y shadowstrike Fluffy_Pillow 56.1/100: 56% energy | 3.0/6: 50% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(5), finality_nightblade(5), potion_of_the_old_war
3:03.373 Waiting     0.200 sec 33.1/100: 33% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(5), finality_nightblade(5), potion_of_the_old_war
3:03.573 finish M eviscerate Fluffy_Pillow 35.3/100: 35% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(5), finality_nightblade(5), potion_of_the_old_war
3:04.577 stealthed Y shadowstrike Fluffy_Pillow 51.3/100: 51% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(5), potion_of_the_old_war
3:05.581 Waiting     2.100 sec 28.3/100: 28% energy | 3.0/6: 50% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(5), potion_of_the_old_war
3:07.681 build G backstab Fluffy_Pillow 51.3/100: 51% energy | 4.0/6: 67% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_nightblade(5), potion_of_the_old_war
3:08.686 Waiting     0.800 sec 27.3/100: 27% energy | 6.0/6: 100% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_nightblade(5), potion_of_the_old_war
3:09.486 finish M eviscerate Fluffy_Pillow 36.1/100: 36% energy | 6.0/6: 100% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_nightblade(5), potion_of_the_old_war
3:10.490 stealth_cds V shadow_dance Fluffy_Pillow 52.1/100: 52% energy | 1.0/6: 17% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(5), potion_of_the_old_war
3:10.490 stealthed Y shadowstrike Fluffy_Pillow 77.1/100: 77% energy | 1.0/6: 17% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(5), potion_of_the_old_war
3:11.493 stealthed Y shadowstrike Fluffy_Pillow 79.0/100: 79% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(5), potion_of_the_old_war
3:12.497 finish L nightblade Fluffy_Pillow 56.0/100: 56% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(5), potion_of_the_old_war
3:13.501 stealthed W symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), potion_of_the_old_war
3:13.501 stealthed Y shadowstrike Fluffy_Pillow 65.0/100: 65% energy | 1.0/6: 17% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, death, finality_eviscerate(6), potion_of_the_old_war
3:14.506 stealthed Y shadowstrike Fluffy_Pillow 67.0/100: 67% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), potion_of_the_old_war
3:15.509 finish M eviscerate Fluffy_Pillow 44.0/100: 44% energy | 6.0/6: 100% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), potion_of_the_old_war
3:16.515 build G backstab Fluffy_Pillow 60.0/100: 60% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, shadow_blades, potion_of_the_old_war
3:17.519 Waiting     1.400 sec 36.0/100: 36% energy | 2.0/6: 33% combo_points master_of_subtlety, symbols_of_death, shadow_blades, potion_of_the_old_war
3:18.919 build G backstab Fluffy_Pillow 51.4/100: 51% energy | 3.0/6: 50% combo_points master_of_subtlety, symbols_of_death, shadow_blades, potion_of_the_old_war
3:19.922 Waiting     0.700 sec 27.3/100: 27% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death, shadow_blades, potion_of_the_old_war
3:20.622 finish M eviscerate Fluffy_Pillow 35.0/100: 35% energy | 5.0/6: 83% combo_points symbols_of_death, shadow_blades, potion_of_the_old_war
3:21.626 stealth_cds V shadow_dance Fluffy_Pillow 51.0/100: 51% energy | 1.0/6: 17% combo_points symbols_of_death, shadow_blades, finality_eviscerate(5), potion_of_the_old_war
3:21.626 stealthed Y shadowstrike Fluffy_Pillow 76.0/100: 76% energy | 1.0/6: 17% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(5), potion_of_the_old_war
3:22.630 stealthed Y shadowstrike Fluffy_Pillow 78.0/100: 78% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(5), potion_of_the_old_war
3:23.635 finish M eviscerate Fluffy_Pillow 55.0/100: 55% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(5), potion_of_the_old_war
3:24.638 stealthed Y shadowstrike Fluffy_Pillow 71.0/100: 71% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, potion_of_the_old_war
3:25.644 stealthed Y shadowstrike Fluffy_Pillow 48.0/100: 48% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades
3:26.650 Waiting     1.000 sec 25.0/100: 25% energy | 6.0/6: 100% combo_points master_of_subtlety, symbols_of_death, shadow_blades
3:27.650 finish M eviscerate Fluffy_Pillow 36.0/100: 36% energy | 6.0/6: 100% combo_points master_of_subtlety, symbols_of_death, shadow_blades
3:28.655 cds K goremaws_bite Fluffy_Pillow 52.0/100: 52% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6)
3:29.659 build G backstab Fluffy_Pillow 68.0/100: 68% energy | 4.0/6: 67% combo_points master_of_subtlety, symbols_of_death, shadow_blades, goremaws_bite, finality_eviscerate(6)
3:30.662 finish M eviscerate Fluffy_Pillow 49.0/100: 49% energy | 6.0/6: 100% combo_points master_of_subtlety, symbols_of_death, shadow_blades, goremaws_bite, finality_eviscerate(6)
3:31.669 stealth_cds V shadow_dance Fluffy_Pillow 70.0/100: 70% energy | 0.0/6: 0% combo_points symbols_of_death, shadow_blades, goremaws_bite
3:31.669 stealthed Y shadowstrike Fluffy_Pillow 95.0/100: 95% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, goremaws_bite
3:32.674 stealthed Y shadowstrike Fluffy_Pillow 77.0/100: 77% energy | 3.0/6: 50% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, goremaws_bite
3:33.679 finish L nightblade Fluffy_Pillow 59.0/100: 59% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, goremaws_bite
3:34.684 stealthed Y shadowstrike Fluffy_Pillow 90.1/100: 90% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6)
3:35.687 stealthed Y shadowstrike Fluffy_Pillow 67.0/100: 67% energy | 3.0/6: 50% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6)
3:36.692 finish M eviscerate Fluffy_Pillow 44.1/100: 44% energy | 6.0/6: 100% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_nightblade(6)
3:37.697 build G backstab Fluffy_Pillow 60.1/100: 60% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6)
3:38.704 Waiting     1.400 sec 36.1/100: 36% energy | 2.0/6: 33% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6)
3:40.104 build G backstab Fluffy_Pillow 51.4/100: 51% energy | 3.0/6: 50% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6)
3:41.108 Waiting     0.700 sec 27.4/100: 27% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6)
3:41.808 finish M eviscerate Fluffy_Pillow 35.1/100: 35% energy | 5.0/6: 83% combo_points symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6)
3:42.812 stealth_cds V shadow_dance Fluffy_Pillow 51.1/100: 51% energy | 1.0/6: 17% combo_points symbols_of_death, shadow_blades, finality_nightblade(6)
3:42.812 stealthed Y shadowstrike Fluffy_Pillow 76.1/100: 76% energy | 1.0/6: 17% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6)
3:43.816 stealthed Y shadowstrike Fluffy_Pillow 53.1/100: 53% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6)
3:44.820 Waiting     0.500 sec 30.1/100: 30% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6)
3:45.320 finish M eviscerate Fluffy_Pillow 35.6/100: 36% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6)
3:46.326 stealthed Y shadowstrike Fluffy_Pillow 91.6/100: 92% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6)
3:47.332 finish M eviscerate Fluffy_Pillow 93.6/100: 94% energy | 5.0/6: 83% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6)
3:48.337 build G backstab Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_nightblade(6)
3:49.343 build G backstab Fluffy_Pillow 76.0/100: 76% energy | 2.0/6: 33% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_nightblade(6)
3:50.348 finish L nightblade Fluffy_Pillow 52.0/100: 52% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death, finality_nightblade(6)
3:51.355 stealth_cds V shadow_dance Fluffy_Pillow 78.1/100: 78% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death
3:51.355 stealthed W symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
3:51.355 stealthed Y shadowstrike Fluffy_Pillow 65.0/100: 65% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, death
3:52.359 stealthed Y shadowstrike Fluffy_Pillow 42.0/100: 42% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
3:53.364 Waiting     1.546 sec 19.0/100: 19% energy | 5.0/6: 83% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
3:54.910 finish M eviscerate Fluffy_Pillow 35.9/100: 36% energy | 5.0/6: 83% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
3:55.914 stealthed Y shadowstrike Fluffy_Pillow 51.9/100: 52% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5)
3:56.921 Waiting     2.100 sec 29.0/100: 29% energy | 2.0/6: 33% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5)
3:59.021 build G backstab Fluffy_Pillow 52.0/100: 52% energy | 4.0/6: 67% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5)
4:00.026 Waiting     0.700 sec 28.0/100: 28% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5)
4:00.726 finish M eviscerate Fluffy_Pillow 35.7/100: 36% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5)
4:01.732 build G backstab Fluffy_Pillow 51.7/100: 52% energy | 0.0/6: 0% combo_points symbols_of_death
4:02.736 Waiting     2.200 sec 27.7/100: 28% energy | 2.0/6: 33% combo_points symbols_of_death
4:04.936 build G backstab Fluffy_Pillow 51.8/100: 52% energy | 2.0/6: 33% combo_points symbols_of_death
4:05.941 Waiting     2.200 sec 27.8/100: 28% energy | 3.0/6: 50% combo_points symbols_of_death
4:08.141 build G backstab Fluffy_Pillow 51.9/100: 52% energy | 4.0/6: 67% combo_points symbols_of_death
4:09.146 finish L nightblade Fluffy_Pillow 27.9/100: 28% energy | 5.0/6: 83% combo_points symbols_of_death
4:10.150 stealth_cds V shadow_dance Fluffy_Pillow 53.9/100: 54% energy | 0.0/6: 0% combo_points symbols_of_death, finality_nightblade(5)
4:10.150 stealthed Y shadowstrike Fluffy_Pillow 78.9/100: 79% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(5)
4:11.155 stealthed Y shadowstrike Fluffy_Pillow 80.9/100: 81% energy | 3.0/6: 50% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(5)
4:12.161 finish M eviscerate Fluffy_Pillow 57.9/100: 58% energy | 5.0/6: 83% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(5)
4:13.166 stealthed Y shadowstrike Fluffy_Pillow 73.9/100: 74% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5), finality_nightblade(5)
4:14.169 stealthed Y shadowstrike Fluffy_Pillow 50.9/100: 51% energy | 3.0/6: 50% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5), finality_nightblade(5)
4:15.171 Waiting     0.700 sec 27.9/100: 28% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5), finality_nightblade(5)
4:15.871 finish M eviscerate Fluffy_Pillow 35.6/100: 36% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5), finality_nightblade(5)
4:16.874 stealth_cds S vanish Fluffy_Pillow 51.6/100: 52% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, finality_nightblade(5)
4:16.874 stealthed Y shadowstrike Fluffy_Pillow 76.6/100: 77% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, vanish, symbols_of_death, finality_nightblade(5)
4:17.878 stealthed Y shadowstrike Fluffy_Pillow 53.6/100: 54% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, vanish, subterfuge, symbols_of_death, finality_nightblade(5)
4:18.883 Waiting     0.900 sec 30.6/100: 31% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, vanish, subterfuge, symbols_of_death, finality_nightblade(5)
4:19.783 stealthed Y shadowstrike Fluffy_Pillow 40.4/100: 40% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, vanish, subterfuge, symbols_of_death, finality_nightblade(5)
4:20.787 finish L nightblade Fluffy_Pillow 42.4/100: 42% energy | 6.0/6: 100% combo_points master_of_subtlety, symbols_of_death, finality_nightblade(5)
4:21.792 build G backstab Fluffy_Pillow 68.4/100: 68% energy | 2.0/6: 33% combo_points master_of_subtlety, symbols_of_death
4:22.796 Waiting     0.600 sec 44.4/100: 44% energy | 3.0/6: 50% combo_points master_of_subtlety, symbols_of_death
4:23.396 build G backstab Fluffy_Pillow 51.0/100: 51% energy | 3.0/6: 50% combo_points master_of_subtlety, symbols_of_death
4:24.399 Waiting     2.200 sec 27.0/100: 27% energy | 4.0/6: 67% combo_points master_of_subtlety, symbols_of_death
4:26.599 build G backstab Fluffy_Pillow 51.1/100: 51% energy | 4.0/6: 67% combo_points symbols_of_death
4:27.605 Waiting     0.800 sec 27.1/100: 27% energy | 6.0/6: 100% combo_points symbols_of_death
4:28.405 finish M eviscerate Fluffy_Pillow 35.9/100: 36% energy | 6.0/6: 100% combo_points symbols_of_death
4:29.410 cds K goremaws_bite Fluffy_Pillow 51.9/100: 52% energy | 0.0/6: 0% combo_points symbols_of_death, finality_eviscerate(6)
4:30.414 build G backstab Fluffy_Pillow 67.9/100: 68% energy | 3.0/6: 50% combo_points symbols_of_death, goremaws_bite, finality_eviscerate(6)
4:31.418 Waiting     0.200 sec 48.9/100: 49% energy | 4.0/6: 67% combo_points symbols_of_death, goremaws_bite, finality_eviscerate(6)
4:31.618 build G backstab Fluffy_Pillow 51.1/100: 51% energy | 4.0/6: 67% combo_points symbols_of_death, goremaws_bite, finality_eviscerate(6)
4:32.623 Waiting     0.300 sec 32.1/100: 32% energy | 6.0/6: 100% combo_points symbols_of_death, goremaws_bite, finality_eviscerate(6)
4:32.923 finish M eviscerate Fluffy_Pillow 35.4/100: 35% energy | 6.0/6: 100% combo_points symbols_of_death, goremaws_bite, finality_eviscerate(6)
4:33.928 stealth_cds T sprint Fluffy_Pillow 56.4/100: 56% energy | 0.0/6: 0% combo_points symbols_of_death, goremaws_bite
4:33.928 stealth_cds V shadow_dance Fluffy_Pillow 56.4/100: 56% energy | 0.0/6: 0% combo_points sprint, symbols_of_death, goremaws_bite, faster_than_light_trigger
4:33.928 stealthed W symbols_of_death Fluffy_Pillow 81.4/100: 81% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, sprint, symbols_of_death, goremaws_bite, faster_than_light_trigger
4:33.928 stealthed Y shadowstrike Fluffy_Pillow 46.4/100: 46% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, sprint, symbols_of_death, goremaws_bite, death, faster_than_light_trigger
4:34.933 stealthed Y shadowstrike Fluffy_Pillow 53.4/100: 53% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, sprint, symbols_of_death, goremaws_bite, faster_than_light_trigger
4:35.937 Waiting     0.500 sec 35.4/100: 35% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, shadow_dance, sprint, symbols_of_death, faster_than_light_trigger
4:36.437 stealthed Y shadowstrike Fluffy_Pillow 40.9/100: 41% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, shadow_dance, sprint, symbols_of_death, faster_than_light_trigger
4:37.443 finish M eviscerate Fluffy_Pillow 42.9/100: 43% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, vanish, subterfuge, sprint, symbols_of_death
4:38.447 stealthed Y shadowstrike Fluffy_Pillow 58.9/100: 59% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, vanish, subterfuge, sprint, symbols_of_death, finality_eviscerate(6)
4:39.451 Waiting     0.400 sec 35.9/100: 36% energy | 3.0/6: 50% combo_points master_of_subtlety, vanish, subterfuge, sprint, symbols_of_death, finality_eviscerate(6)
4:39.851 stealthed Y shadowstrike Fluffy_Pillow 40.3/100: 40% energy | 3.0/6: 50% combo_points master_of_subtlety, vanish, subterfuge, sprint, symbols_of_death, finality_eviscerate(6)
4:40.854 finish M eviscerate Fluffy_Pillow 42.3/100: 42% energy | 5.0/6: 83% combo_points master_of_subtlety, sprint, symbols_of_death, finality_eviscerate(6)
4:41.858 stealth_cds V shadow_dance Fluffy_Pillow 58.3/100: 58% energy | 0.0/6: 0% combo_points master_of_subtlety, sprint, symbols_of_death
4:41.858 stealthed Y shadowstrike Fluffy_Pillow 83.3/100: 83% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, sprint, symbols_of_death
4:42.863 stealthed Y shadowstrike Fluffy_Pillow 60.3/100: 60% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
4:43.867 finish L nightblade Fluffy_Pillow 37.3/100: 37% energy | 5.0/6: 83% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
4:44.872 stealthed Y shadowstrike Fluffy_Pillow 63.3/100: 63% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(5)
4:45.878 stealthed Y shadowstrike Fluffy_Pillow 40.3/100: 40% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(5)
4:46.883 Waiting     0.800 sec 42.3/100: 42% energy | 4.0/6: 67% combo_points master_of_subtlety, symbols_of_death, finality_nightblade(5)
4:47.683 build G backstab Fluffy_Pillow 51.1/100: 51% energy | 4.0/6: 67% combo_points master_of_subtlety, symbols_of_death, finality_nightblade(5)
4:48.687 Waiting     0.800 sec 27.1/100: 27% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death, finality_nightblade(5)
4:49.487 finish M eviscerate Fluffy_Pillow 35.8/100: 36% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death, finality_nightblade(5)
4:50.493 stealth_cds V shadow_dance Fluffy_Pillow 51.9/100: 52% energy | 1.0/6: 17% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5), finality_nightblade(5)
4:50.493 stealthed Y shadowstrike Fluffy_Pillow 76.9/100: 77% energy | 1.0/6: 17% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5), finality_nightblade(5)
4:51.499 stealthed Y shadowstrike Fluffy_Pillow 53.9/100: 54% energy | 3.0/6: 50% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5), finality_nightblade(5)
4:52.502 Waiting     0.400 sec 30.9/100: 31% energy | 5.0/6: 83% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5), finality_nightblade(5)
4:52.902 finish M eviscerate Fluffy_Pillow 35.2/100: 35% energy | 5.0/6: 83% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5), finality_nightblade(5)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 8806 8481 0
Agility 31670 29964 19508 (12382)
Stamina 48391 48391 28183
Intellect 5325 5000 0
Spirit 0 0 0
Health 2903460 2903460 0
Energy 100 100 0
Combo Points 6 6 0
Crit 23.64% 23.64% 5456
Haste 9.55% 9.55% 3581
Damage / Heal Versatility 9.03% 8.23% 3909
Attack Power 31670 29964 0
Mastery 95.94% 95.94% 10703
Armor 2297 2297 2297
Run Speed 8 0 0

Gear

Source Slot Average Item Level: 887.00
Local Head Cowl of Fright
ilevel: 885, stats: { 300 Armor, +2829 Sta, +1886 AgiInt, +1015 Mastery, +547 Crit, +1076 unknown }
Local Neck Sea Fan Pendant
ilevel: 880, stats: { +1519 Sta, +1633 Vers, +965 Mastery }, enchant: mark_of_the_hidden_satyr
Local Shoulders Steelgazer Hide Mantle
ilevel: 880, stats: { 273 Armor, +1351 AgiInt, +2027 Sta, +673 Haste, +476 Vers, +771 unknown }
Local Shirt Common Gray Shirt
ilevel: 1
Local Chest Biornskin Vest
ilevel: 890, stats: { 376 Armor, +1977 AgiInt, +2965 Sta, +1034 Crit, +557 Mastery }
Local Waist Strand of Whelk Shells
ilevel: 880, stats: { 205 Armor, +2026 Sta, +1351 AgiInt, +673 Haste, +476 Mastery }, gems: { +150 Mastery }
Local Legs Legwraps of Unworthy Souls
ilevel: 880, stats: { 318 Armor, +2701 Sta, +1801 AgiInt, +964 Mastery, +570 Haste }
Local Feet Shadow Satyr's Walk
ilevel: 910, stats: { 276 Armor, +2680 Sta, +1786 Agi, +827 Haste, +459 Mastery }
Local Wrists Denial of the Half-Giants
ilevel: 910, stats: { 176 Armor, +2010 Sta, +1340 Agi, +276 Crit, +689 Mastery }
Local Hands Cruel Vice Grips
ilevel: 885, stats: { 231 Armor, +2122 Sta, +1415 AgiInt, +686 Crit, +485 Mastery }
Local Finger1 Grubby Silver Ring
ilevel: 880, stats: { +1519 Sta, +1484 Crit, +1114 Vers }, gems: { +150 Vers }, enchant: { +200 Mastery }
Local Finger2 Ring of Collapsing Futures
ilevel: 870, stats: { +1385 Sta, +1677 Mastery, +768 Haste, +419 Avoidance }, enchant: { +200 Vers }
Local Trinket1 Eye of Guarm
ilevel: 875, stats: { +1634 Agi, +1075 Mastery }
Local Trinket2 Ethereal Urn
ilevel: 875, stats: { +1634 StrAgiInt, +1075 Mastery }
Local Back Drape of the Mana-Starved
ilevel: 875, stats: { 142 Armor, +1450 Sta, +967 StrAgiInt, +586 Crit, +259 Vers }, gems: { +200 Agi }, enchant: { +200 Agi }
Local Main Hand Fangs of the Devourer
ilevel: 906, weapon: { 3844 - 7140, 1.8 }, stats: { +983 Agi, +1475 Sta, +368 Crit, +353 Mastery }, relics: { +53 ilevels, +51 ilevels, +52 ilevels }
Local Off Hand Fangs of the Devourer
ilevel: 906, weapon: { 3844 - 7140, 1.8 }, stats: { +983 Agi, +1475 Sta, +368 Crit, +353 Mastery }

Talents

Level
15 Master of Subtlety (Subtlety Rogue) Weaponmaster (Subtlety Rogue) Gloomblade (Subtlety Rogue)
30 Nightstalker Subterfuge Shadow Focus
45 Deeper Stratagem Anticipation Vigor
60 Soothing Darkness (Subtlety Rogue) Elusiveness Cheat Death
75 Strike from the Shadows (Subtlety Rogue) Prey on the Weak Tangled Shadow (Subtlety Rogue)
90 Premeditation (Subtlety Rogue) Alacrity Enveloping Shadows (Subtlety Rogue)
100 Master of Shadows (Subtlety Rogue) Marked for Death Death from Above

Profile

rogue="Equipped"
origin="https://eu.api.battle.net/wow/character/dalaran/Esdeåth/advanced"
level=110
race=human
role=attack
position=back
professions=alchemy=800/enchanting=133
talents=1210011
artifact=17:0:0:0:0:851:1:852:3:853:3:854:3:855:3:856:3:857:3:858:3:859:3:860:3:861:1:862:1:863:1:864:1:865:1:866:1:1349:1:1386:14
spec=subtlety

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,name=flask_of_the_seventh_demon
actions.precombat+=/augmentation,name=defiled
actions.precombat+=/food,name=seedbattered_fish_plate
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/stealth
actions.precombat+=/potion,name=old_war
actions.precombat+=/marked_for_death,if=raid_event.adds.in>40
# Defined variables that doesn't change during the fight
actions.precombat+=/variable,name=ssw_refund,value=equipped.shadow_satyrs_walk*(4+ssw_refund_offset)
actions.precombat+=/variable,name=stealth_threshold,value=(15+talent.vigor.enabled*35+talent.master_of_shadows.enabled*30+variable.ssw_refund)
actions.precombat+=/enveloping_shadows,if=combo_points>=5
actions.precombat+=/symbols_of_death

# Executed every time the actor is available.
actions=call_action_list,name=cds
# Fully switch to the Stealthed Rotation (by doing so, it forces pooling if nothing is available)
actions+=/run_action_list,name=stealthed,if=stealthed.all
actions+=/call_action_list,name=finish,if=combo_points>=5|(combo_points>=4&spell_targets.shuriken_storm>=3&spell_targets.shuriken_storm<=4)
actions+=/call_action_list,name=stealth_als,if=combo_points.deficit>=2+talent.premeditation.enabled
actions+=/call_action_list,name=build,if=energy.deficit<=variable.stealth_threshold

# Builders
actions.build=shuriken_storm,if=spell_targets.shuriken_storm>=2
actions.build+=/gloomblade
actions.build+=/backstab

# Cooldowns
actions.cds=potion,name=old_war,if=buff.bloodlust.react|target.time_to_die<=25|buff.shadow_blades.up
actions.cds+=/use_item,slot=finger2,if=(buff.shadow_blades.up&stealthed.rogue)|target.time_to_die<20
actions.cds+=/blood_fury,if=stealthed.rogue
actions.cds+=/berserking,if=stealthed.rogue
actions.cds+=/arcane_torrent,if=stealthed.rogue&energy.deficit>70
actions.cds+=/shadow_blades,if=combo_points<=2|(equipped.denial_of_the_halfgiants&combo_points>=1)
actions.cds+=/goremaws_bite,if=!stealthed.all&cooldown.shadow_dance.charges_fractional<=2.45&((combo_points.deficit>=4-(time<10)*2&energy.deficit>50+talent.vigor.enabled*25-(time>=10)*15)|target.time_to_die<8)
actions.cds+=/marked_for_death,target_if=min:target.time_to_die,if=target.time_to_die<combo_points.deficit|(raid_event.adds.in>40&combo_points.deficit>=4+talent.deeper_strategem.enabled+talent.anticipation.enabled)

# Finishers
actions.finish=enveloping_shadows,if=buff.enveloping_shadows.remains<target.time_to_die&buff.enveloping_shadows.remains<=combo_points*1.8
actions.finish+=/death_from_above,if=spell_targets.death_from_above>=6
actions.finish+=/nightblade,cycle_targets=1,if=target.time_to_die>8&((refreshable&(!finality|buff.finality_nightblade.up))|remains<tick_time)
actions.finish+=/death_from_above
actions.finish+=/eviscerate

# Stealth Action List Starter
actions.stealth_als=call_action_list,name=stealth_cds,if=energy.deficit<=variable.stealth_threshold&(!equipped.shadow_satyrs_walk|cooldown.shadow_dance.charges_fractional>=2.45|energy.deficit>=10)
actions.stealth_als+=/call_action_list,name=stealth_cds,if=spell_targets.shuriken_storm>=5
actions.stealth_als+=/call_action_list,name=stealth_cds,if=(cooldown.shadowmeld.up&!cooldown.vanish.up&cooldown.shadow_dance.charges<=1)
actions.stealth_als+=/call_action_list,name=stealth_cds,if=target.time_to_die<12*cooldown.shadow_dance.charges_fractional*(1+equipped.shadow_satyrs_walk*0.5)

# Stealth Cooldowns
actions.stealth_cds=shadow_dance,if=charges_fractional>=2.45
actions.stealth_cds+=/vanish
actions.stealth_cds+=/sprint_offensive
actions.stealth_cds+=/shadow_dance,if=charges>=2&combo_points<=1
actions.stealth_cds+=/pool_resource,for_next=1,extra_amount=40
actions.stealth_cds+=/shadowmeld,if=energy>=40&energy.deficit>=10+variable.ssw_refund
actions.stealth_cds+=/shadow_dance,if=combo_points<=1

# Stealthed Rotation
actions.stealthed=symbols_of_death,if=(buff.symbols_of_death.remains<target.time_to_die-4&buff.symbols_of_death.remains<=buff.symbols_of_death.duration*0.3)|equipped.shadow_satyrs_walk&energy.time_to_max<0.25
actions.stealthed+=/call_action_list,name=finish,if=combo_points>=5
actions.stealthed+=/shuriken_storm,if=buff.shadowmeld.down&((combo_points.deficit>=3&spell_targets.shuriken_storm>=2+talent.premeditation.enabled+equipped.shadow_satyrs_walk)|buff.the_dreadlords_deceit.stack>=29)
actions.stealthed+=/shadowstrike

head=cowl_of_fright,id=139205,bonus_id=1805/43/1507/3337
neck=sea_fan_pendant,id=142428,bonus_id=3507/1497,enchant=mark_of_the_hidden_satyr
shoulders=steelgazer_hide_mantle,id=134154,bonus_id=3417/43/1542/3337
back=drape_of_the_manastarved,id=141543,bonus_id=1808/1487/3337,gems=200agi,enchant=200agi
chest=biornskin_vest,id=134197,bonus_id=3417/1552/3337
shirt=common_gray_shirt,id=3428
wrists=denial_of_the_halfgiants,id=137100,bonus_id=3459/3458
hands=cruel_vice_grips,id=133617,bonus_id=3510/1537/3337
waist=strand_of_whelk_shells,id=142416,bonus_id=3507/1808/1497,gems=150mastery
legs=legwraps_of_unworthy_souls,id=133616,bonus_id=3418/1532/3337
feet=shadow_satyrs_walk,id=137032,bonus_id=3459/3458
finger1=grubby_silver_ring,id=139236,bonus_id=1806/1808/1502,gems=150vers,enchant=200mastery
finger2=ring_of_collapsing_futures,id=142173,bonus_id=40/3453/1482/3336,enchant=200vers
trinket1=eye_of_guarm,id=142506,bonus_id=3468/605/1492
trinket2=ethereal_urn,id=142166,bonus_id=3454/1472
main_hand=fangs_of_the_devourer,id=128476,bonus_id=743,gem_id=139267/142512/139253/0,relic_id=1806:1507:3336/3468:1492/1806:1502/0
off_hand=fangs_of_the_devourer,id=128479

# Gear Summary
# gear_ilvl=886.69
# gear_agility=19508
# gear_stamina=28183
# gear_crit_rating=5349
# gear_haste_rating=3511
# gear_mastery_rating=10493
# gear_versatility_rating=3832
# gear_avoidance_rating=419
# gear_armor=2297

EsdeathSAMA

EsdeathSAMA : 479307 dps

  • Race: Human
  • Class: Rogue
  • Spec: Subtlety
  • Level: 110
  • Role: Attack
  • Position: back

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
479307.1 479307.1 573.1 / 0.120% 79095.5 / 16.5% 16564.2
RPS Out RPS In Primary Resource Waiting APM Active Skill
28.8 28.8 Energy 23.10% 56.5 100.0% 100%
Origin https://eu.api.battle.net/wow/character/dalaran/Esdeåth/advanced
Talents
  • 15: Master of Subtlety (Subtlety Rogue)
  • 30: Subterfuge
  • 45: Deeper Stratagem
  • 90: Premeditation (Subtlety Rogue)
  • 100: Master of Shadows (Subtlety Rogue)
  • Talent Calculator
Artifact
Professions
  • alchemy: 800
  • enchanting: 133

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
EsdeathSAMA 479307
auto_attack_mh 9159 1.9% 119.6 2.04sec 23268 14632 Direct 119.6 22260 44519 23269 23.6% 19.1%  

Stats details: auto_attack_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 119.65 119.65 0.00 0.00 1.5902 0.0000 2783989.76 4092728.65 31.98 14632.09 14632.09
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 68.60 57.33% 22260.08 17214 22722 22266.43 21540 22680 1526983 2244809 31.98
crit 28.24 23.60% 44519.06 34428 45444 44530.76 42415 45444 1257007 1847919 31.98
miss 22.81 19.07% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_mh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
auto_attack_oh 4548 1.0% 118.7 2.06sec 11649 7269 Direct 118.7 11129 22259 11648 23.7% 19.0%  

Stats details: auto_attack_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 118.74 118.74 0.00 0.00 1.6026 0.0000 1383131.91 2033334.92 31.98 7268.51 7268.51
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 68.03 57.29% 11129.27 8607 11361 11132.80 10868 11307 757098 1113006 31.98
crit 28.12 23.69% 22259.45 17214 22722 22264.03 21403 22722 626034 920329 31.98
miss 22.58 19.02% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_oh

Static Values
  • id:1
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Backstab 25728 5.4% 51.3 5.61sec 151666 150989 Direct 51.3 122610 245197 151659 23.7% 0.0%  

Stats details: backstab

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 51.30 51.30 0.00 0.00 1.0045 0.0000 7780906.61 11438669.75 31.98 150988.82 150988.82
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.14 76.30% 122609.62 95278 125768 122642.85 118254 125768 4799351 7055500 31.98
crit 12.16 23.70% 245197.20 190557 251535 245280.80 228124 251535 2981556 4383170 31.98
 
 

Action details: backstab

Static Values
  • id:53
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:53
  • name:Backstab
  • school:physical
  • tooltip:
  • description:Stab the target, causing ${$sw2*$<mult>} Physical damage. Damage increased by {$s4=30}% when you are behind your target. |cFFFFFFFFAwards {$s3=1} combo $lpoint:points;.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.70
 
Collapse 1627 0.3% 5.9 43.53sec 82001 0 Direct 5.9 66468 132955 81996 23.4% 0.0%  

Stats details: collapse

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.89 5.89 0.00 0.00 0.0000 0.0000 483014.72 483014.72 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.51 76.64% 66468.12 50574 66758 66044.03 0 66758 300059 300059 0.00
crit 1.38 23.36% 132954.86 101148 133516 99101.09 0 133516 182955 182955 0.00
 
 

Action details: collapse

Static Values
  • id:234142
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:15.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:234142
  • name:Collapse
  • school:shadow
  • tooltip:
  • description:Deal {$s1=40000} Shadow damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:40000.00
  • base_dd_max:40000.00
 
Eviscerate 146581 30.5% 53.1 5.62sec 826715 823024 Direct 53.1 596229 1191775 826706 38.7% 0.0%  

Stats details: eviscerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 53.12 53.12 0.00 0.00 1.0045 0.0000 43916585.63 64561540.77 31.98 823024.47 823024.47
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 32.56 61.30% 596228.97 369897 726537 596611.13 547367 651583 19415024 28541925 31.98
crit 20.56 38.70% 1191775.44 739794 1453074 1192347.46 1074638 1340355 24501561 36019616 31.98
 
 

Action details: eviscerate

Static Values
  • id:196819
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.15
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:196819
  • name:Eviscerate
  • school:physical
  • tooltip:
  • description:Finishing move that disembowels the target, causing damage per combo point. 1 point : ${$m1*1} damage 2 points: ${$m1*2} damage 3 points: ${$m1*3} damage 4 points: ${$m1*4} damage 5 points: ${$m1*5} damage{$?s193531=false}[ 6 points: ${$m1*6} damage][]
Weapon
  • normalized:false
  • weapon_power_mod:0.000000
  • weapon_multiplier:0.00
 
Goremaw's Bite 0 (8922) 0.0% (1.9%) 4.7 63.41sec 575383 572898

Stats details: goremaws_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.67 0.00 0.00 0.00 1.0045 0.0000 0.00 0.00 0.00 572898.15 572898.15
 
 

Action details: goremaws_bite

Static Values
  • id:209782
  • school:shadow
  • resource:none
  • range:8.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!stealthed.all&cooldown.shadow_dance.charges_fractional<=2.45&((combo_points.deficit>=4-(time<10)*2&energy.deficit>50+talent.vigor.enabled*25-(time>=10)*15)|target.time_to_die<8)
Spelldata
  • id:209782
  • name:Goremaw's Bite
  • school:physical
  • tooltip:
  • description:Lashes out at the target, inflicting ${$209783sw2+$209784sw2} Shadow damage and reducing movement speed by {$209786s1=60}% for {$209786d=8 seconds}. Grants $220901o2 Energy over {$220901d=6 seconds}. |cFFFFFFFFAwards {$220901s1=3} combo $lpoint:points;.|r
 
    Goremaw's Bite (_mh) 5932 1.2% 4.7 63.41sec 382525 0 Direct 4.7 310950 621760 382532 23.0% 0.0%  

Stats details: goremaws_bite_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.67 4.67 0.00 0.00 0.0000 0.0000 1787055.11 1787055.11 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 3.60 76.97% 310949.62 242871 320590 310436.60 0 320590 1118140 1118140 0.00
crit 1.08 23.03% 621760.48 485742 641179 436723.28 0 641179 668915 668915 0.00
 
 

Action details: goremaws_bite_mh

Static Values
  • id:209783
  • school:shadow
  • resource:none
  • range:8.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:209783
  • name:Goremaw's Bite
  • school:shadow
  • tooltip:
  • description:{$@spelldesc209782=Lashes out at the target, inflicting ${$209783sw2+$209784sw2} Shadow damage and reducing movement speed by {$209786s1=60}% for {$209786d=8 seconds}. Grants $220901o2 Energy over {$220901d=6 seconds}. |cFFFFFFFFAwards {$220901s1=3} combo $lpoint:points;.|r}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:10.00
 
    Goremaw's Bite (_oh) 2991 0.6% 4.7 63.41sec 192858 0 Direct 4.7 155488 310866 192842 24.1% 0.0%  

Stats details: goremaws_bite_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.67 4.67 0.00 0.00 0.0000 0.0000 900983.02 900983.02 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 3.55 75.95% 155488.19 121442 160303 155199.59 0 160303 551690 551690 0.00
crit 1.12 24.05% 310865.94 242884 320606 222046.26 0 320606 349293 349293 0.00
 
 

Action details: goremaws_bite_oh

Static Values
  • id:209784
  • school:shadow
  • resource:none
  • range:8.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:209784
  • name:Goremaw's Bite
  • school:shadow
  • tooltip:
  • description:{$@spelldesc209782=Lashes out at the target, inflicting ${$209783sw2+$209784sw2} Shadow damage and reducing movement speed by {$209786s1=60}% for {$209786d=8 seconds}. Grants $220901o2 Energy over {$220901d=6 seconds}. |cFFFFFFFFAwards {$220901s1=3} combo $lpoint:points;.|r}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:10.00
 
Mark of the Hidden Satyr 7475 1.6% 16.3 18.10sec 138156 0 Direct 16.3 111627 223214 138153 23.8% 0.0%  

Stats details: mark_of_the_hidden_satyr

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.29 16.29 0.00 0.00 0.0000 0.0000 2250704.40 2250704.40 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 12.42 76.23% 111627.14 85827 113292 111650.37 105138 113292 1386198 1386198 0.00
crit 3.87 23.77% 223214.30 171654 226584 218923.25 0 226584 864506 864506 0.00
 
 

Action details: mark_of_the_hidden_satyr

Static Values
  • id:191259
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191259
  • name:Mark of the Hidden Satyr
  • school:fire
  • tooltip:
  • description:Deals fire damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:2.500000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Nightblade 102062 21.4% 17.1 17.50sec 1800623 1792580 Periodic 144.6 171959 343881 212523 23.6% 0.0% 96.0%

Stats details: nightblade

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.07 0.00 144.63 144.63 1.0045 2.0000 30737377.59 30737377.59 0.00 100314.87 1792580.49
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 110.5 76.41% 171958.77 117272 191956 172001.54 167065 176276 19002457 19002457 0.00
crit 34.1 23.59% 343880.85 234545 383913 343948.98 321787 366975 11734920 11734920 0.00
 
 

Action details: nightblade

Static Values
  • id:195452
  • school:shadow
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:25.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:target.time_to_die>8&((refreshable&(!finality|buff.finality_nightblade.up))|remains<tick_time)
Spelldata
  • id:195452
  • name:Nightblade
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec and snared by attacks.
  • description:Finishing move that infects the target with shadowy energy, dealing Shadow damage over time and causing attacks against the target to reduce movement speed by {$206760s1=30}% for {$206760d=8 seconds}. Lasts longer per combo point. 1 point : ${$m1*8/2} over 8 sec 2 points: ${$m1*10/2} over 10 sec 3 points: ${$m1*12/2} over 12 sec 4 points: ${$m1*14/2} over 14 sec 5 points: ${$m1*16/2} over 16 sec{$?s193531=false}[ 6 points: ${$m1*18/2} over 18 sec][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:1.380000
  • spell_power_mod.tick:0.000000
  • base_td:1.00
  • dot_duration:6.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Potion of the Old War 18484 3.8% 23.1 8.18sec 236593 0 Direct 23.1 191575 383077 236588 23.5% 0.0%  

Stats details: potion_of_the_old_war

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.09 23.09 0.00 0.00 0.0000 0.0000 5463749.73 8032229.64 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.66 76.49% 191574.77 146122 192882 191572.19 181609 192882 3384079 4974917 31.98
crit 5.43 23.51% 383076.62 292245 385763 381789.72 0 385763 2079671 3057313 31.87
 
 

Action details: potion_of_the_old_war

Static Values
  • id:188028
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188028
  • name:Potion of the Old War
  • school:physical
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:135920.00
  • base_dd_max:203880.00
 
Shadow Blades 0 (13783) 0.0% (2.8%) 2.1 180.24sec 1945345 0

Stats details: shadow_blades

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.10 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: shadow_blades

Static Values
  • id:121471
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:combo_points<=2|(equipped.denial_of_the_halfgiants&combo_points>=1)
Spelldata
  • id:121471
  • name:Shadow Blades
  • school:physical
  • tooltip:Autoattacks deal pure Shadow damage. Combo-point-generating attacks generate {$s2=1} additional combo point.
  • description:Draws upon surrounding shadows to empower your weapons, causing auto attacks to deal Shadow damage and abilities that generate combo points to generate 1 additional combo point. Lasts {$d=15 seconds}.
 
    Shadow Blade (_mh) 9185 1.9% 66.3 3.61sec 40956 28246 Direct 66.3 33146 66301 40956 23.6% 0.0%  

Stats details: shadow_blade_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 66.34 66.34 0.00 0.00 1.4499 0.0000 2717034.19 2717034.19 0.00 28246.24 28246.24
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 50.71 76.45% 33146.11 25306 33404 33144.26 32197 33404 1681005 1681005 0.00
crit 15.63 23.55% 66301.08 50612 66808 66295.31 61839 66808 1036029 1036029 0.00
 
 

Action details: shadow_blade_mh

Static Values
  • id:121473
  • school:shadow
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:121473
  • name:Shadow Blade
  • school:shadow
  • tooltip:
  • description:Strike with dark energy, dealing Shadow damage equal to {$s1=1}% weapon damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
    Shadow Blade Off-hand 4599 0.9% 66.3 3.61sec 20507 14143 Direct 66.3 16574 33142 20506 23.7% 0.0%  

Stats details: shadow_blade_offhand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 66.34 66.34 0.00 0.00 1.4499 0.0000 1360446.00 1360446.00 0.00 14143.17 14143.17
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 50.59 76.26% 16574.39 12653 16702 16573.45 16259 16702 838574 838574 0.00
crit 15.75 23.74% 33141.96 25306 33404 33139.61 30367 33404 521872 521872 0.00
 
 

Action details: shadow_blade_offhand

Static Values
  • id:121474
  • school:shadow
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:121474
  • name:Shadow Blade Off-hand
  • school:shadow
  • tooltip:
  • description:Strike with dark energy, dealing Shadow damage equal to {$s1=1}% weapon damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Shadow Nova 9346 2.0% 32.1 9.58sec 87408 0 Direct 32.1 70689 141383 87407 23.7% 0.0%  

Stats details: shadow_nova

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 32.10 32.10 0.00 0.00 0.0000 0.0000 2805440.52 2805440.52 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 24.51 76.35% 70688.56 58912 70694 70688.80 70040 70694 1732244 1732244 0.00
crit 7.59 23.65% 141382.69 117824 141388 141354.29 0 141388 1073196 1073196 0.00
 
 

Action details: shadow_nova

Static Values
  • id:197800
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:5.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:197800
  • name:Shadow Nova
  • school:shadow
  • tooltip:
  • description:Deals {$s1=0} Shadow damage to enemies with $A1 yards.
 
Shadowstrike 107570 (131593) 22.4% (27.4%) 104.4 2.89sec 378127 376436 Direct 104.4 232323 464661 309094 33.0% 0.0%  

Stats details: shadowstrike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 104.36 104.36 0.00 0.00 1.0045 0.0000 32256702.01 47420407.40 31.98 376436.02 376436.02
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 69.88 66.96% 232323.19 193617 232340 232324.36 230149 232340 16233948 23865441 31.98
crit 34.48 33.04% 464660.73 387234 464681 464660.52 459340 464681 16022754 23554967 31.98
 
 

Action details: shadowstrike

Static Values
  • id:185438
  • school:physical
  • resource:energy
  • range:15.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:185438
  • name:Shadowstrike
  • school:physical
  • tooltip:
  • description:Strike through the shadows, $?a231718[appearing behind your target and ][]dealing $sw2 Physical damage. |cFFFFFFFFAwards {$s3=1} combo $lpoint:points;.|r
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:8.50
 
    Soul Rip 24022 5.0% 103.8 2.87sec 69410 0 Direct 103.8 56108 112216 69410 23.7% 0.0%  

Stats details: soul_rip

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 103.79 103.79 0.00 0.00 0.0000 0.0000 7204333.56 7204333.56 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 79.19 76.29% 56107.78 56108 56108 56107.78 56108 56108 4442942 4442942 0.00
crit 24.61 23.71% 112215.57 112216 112216 112215.57 112216 112216 2761392 2761392 0.00
 
 

Action details: soul_rip

Static Values
  • id:220893
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:220893
  • name:Soul Rip
  • school:shadow
  • tooltip:
  • description:{$@spelldesc209835=After using Shadowstrike or Cheap Shot, Akaari's Soul appears $m1 sec later and Soul Rips your target, dealing {$220893s1=1} Shadow damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:1.500000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Simple Action Stats Execute Interval
EsdeathSAMA
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:EsdeathSAMA
  • harmful:false
  • if_expr:
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:EsdeathSAMA
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:EsdeathSAMA
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Shadow Dance 26.2 11.51sec

Stats details: shadow_dance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 26.21 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: shadow_dance

Static Values
  • id:185313
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:charges_fractional>=2.45
Spelldata
  • id:185313
  • name:Shadow Dance
  • school:physical
  • tooltip:
  • description:Allows use of all Stealth abilities and grants all the combat benefits of Stealth for {$d=3 seconds}. Effect not broken from taking damage or attacking. {$?s14062=false}[Movement speed while active is increased by {$1784s3=0}% and damage dealt is increased by {$1784s4=0}%. ]?s108209[Abilities cost {$112942s1=75}% less while active. ][]{$?s31223=false}[Attacks from Shadow Dance and for {$31223s1=5} sec after deal {$31665s1=10}% more damage. ][]
 
Sprint 2.7 122.28sec

Stats details: sprint

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.74 0.00 86.82 0.00 0.0000 0.2500 0.00 0.00 0.00 0.00 0.00
 
 

Action details: sprint

Static Values
  • id:2983
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:2983
  • name:Sprint
  • school:physical
  • tooltip:Movement speed increased by $w1%.
  • description:Increases your movement speed by {$s1=70}% for {$d=8 seconds}. Usable while stealthed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:0.25
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Symbols of Death 13.2 23.94sec

Stats details: symbols_of_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.21 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: symbols_of_death

Static Values
  • id:212283
  • school:physical
  • resource:energy
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:10.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:212283
  • name:Symbols of Death
  • school:physical
  • tooltip:All damage done increased by {$s1=20}%.
  • description:Invoke ancient symbols of power, increasing all damage you deal by {$s1=20}% for {$d=35 seconds}, and causing your next Shadowstrike to critically strike. Unaffected by the global cooldown.
 
Vanish 2.9 122.18sec

Stats details: vanish

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.85 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: vanish

Static Values
  • id:1856
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:1856
  • name:Vanish
  • school:physical
  • tooltip:Improved stealth.
  • description:Allows you to vanish from sight, entering stealth while in combat. For the first {$11327d=3 seconds} after vanishing, damage and harmful effects received will not break stealth. Also breaks movement impairing effects.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 37.59% 0.0(0.0) 1.0

Buff details

  • buff initial source:EsdeathSAMA
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Death 13.2 0.0 22.9sec 24.0sec 1.55% 12.47% 0.0(0.0) 0.2

Buff details

  • buff initial source:EsdeathSAMA
  • cooldown name:buff_death
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • death_1:1.55%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:227151
  • name:Death
  • tooltip:Your next Shadowstrike will critically strike.
  • description:{$@spelldesc212283=Invoke ancient symbols of power, increasing all damage you deal by {$s1=20}% for {$d=35 seconds}, and causing your next Shadowstrike to critically strike. Unaffected by the global cooldown.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Faster Than Light Trigger 2.7 0.0 122.3sec 122.3sec 2.72% 2.72% 0.0(0.0) 2.7

Buff details

  • buff initial source:EsdeathSAMA
  • cooldown name:buff_faster_than_light_trigger
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • faster_than_light_trigger_1:2.72%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:197270
  • name:Faster Than Light Trigger
  • tooltip:
  • description:
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
Finality: Eviscerate 26.8 0.0 11.3sec 11.3sec 48.94% 49.53% 0.0(0.0) 0.0

Buff details

  • buff initial source:EsdeathSAMA
  • cooldown name:buff_finality_eviscerate
  • max_stacks:10
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.04

Stack Uptimes

  • finality_eviscerate_5:22.41%
  • finality_eviscerate_6:26.54%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:197496
  • name:Finality: Eviscerate
  • tooltip:Your next Eviscerate will do $w1% increased damage.
  • description:
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Finality: Nightblade 8.7 0.0 35.2sec 35.2sec 42.94% 40.96% 0.0(0.0) 0.0

Buff details

  • buff initial source:EsdeathSAMA
  • cooldown name:buff_finality_nightblade
  • max_stacks:6
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.04

Stack Uptimes

  • finality_nightblade_5:17.61%
  • finality_nightblade_6:25.33%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:197498
  • name:Finality: Nightblade
  • tooltip:Your next Nightblade will do $w1% increased damage.
  • description:
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Goremaw's Bite 4.7 0.0 63.5sec 63.5sec 9.20% 9.20% 27.7(27.7) 4.6

Buff details

  • buff initial source:EsdeathSAMA
  • cooldown name:buff_goremaws_bite
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • goremaws_bite_1:9.20%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:220901
  • name:Goremaw's Bite
  • tooltip:Generating {$s2=5} Energy every $t2 sec.
  • description:{$@spelldesc209782=Lashes out at the target, inflicting ${$209783sw2+$209784sw2} Shadow damage and reducing movement speed by {$209786s1=60}% for {$209786d=8 seconds}. Grants $220901o2 Energy over {$220901d=6 seconds}. |cFFFFFFFFAwards {$220901s1=3} combo $lpoint:points;.|r}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Master of Subtlety 36.9 1.4 8.2sec 7.9sec 34.58% 47.62% 1.4(1.4) 12.7

Buff details

  • buff initial source:EsdeathSAMA
  • cooldown name:buff_master_of_subtlety
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • master_of_subtlety_1:34.58%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:31223
  • name:Master of Subtlety
  • tooltip:
  • description:Attacks made while stealthed and for {$s1=5} seconds after breaking stealth cause an additional {$31665s1=10}% damage.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Master of Subtlety (_aura) 36.9 1.4 8.2sec 8.0sec 48.45% 34.18% 1.4(1.4) 0.0

Buff details

  • buff initial source:EsdeathSAMA
  • cooldown name:buff_master_of_subtlety_aura
  • max_stacks:1
  • duration:150.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • master_of_subtlety_aura_1:48.45%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:31223
  • name:Master of Subtlety
  • tooltip:
  • description:Attacks made while stealthed and for {$s1=5} seconds after breaking stealth cause an additional {$31665s1=10}% damage.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of the Old War 2.0 0.0 152.3sec 0.0sec 16.24% 16.24% 0.0(0.0) 2.0

Buff details

  • buff initial source:EsdeathSAMA
  • cooldown name:buff_potion_of_the_old_war
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_the_old_war_1:16.24%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188028
  • name:Potion of the Old War
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Shadow Blades 2.1 0.0 180.2sec 180.2sec 34.58% 39.73% 0.0(0.0) 2.0

Buff details

  • buff initial source:EsdeathSAMA
  • cooldown name:buff_shadow_blades
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • shadow_blades_1:34.58%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:121471
  • name:Shadow Blades
  • tooltip:Autoattacks deal pure Shadow damage. Combo-point-generating attacks generate {$s2=1} additional combo point.
  • description:Draws upon surrounding shadows to empower your weapons, causing auto attacks to deal Shadow damage and abilities that generate combo points to generate 1 additional combo point. Lasts {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Shadow Dance 26.2 0.0 11.5sec 11.5sec 43.40% 43.40% 0.0(0.0) 25.9

Buff details

  • buff initial source:EsdeathSAMA
  • cooldown name:buff_shadow_dance
  • max_stacks:1
  • duration:5.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • shadow_dance_1:43.40%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:185313
  • name:Shadow Dance
  • tooltip:
  • description:Allows use of all Stealth abilities and grants all the combat benefits of Stealth for {$d=3 seconds}. Effect not broken from taking damage or attacking. {$?s14062=false}[Movement speed while active is increased by {$1784s3=0}% and damage dealt is increased by {$1784s4=0}%. ]?s108209[Abilities cost {$112942s1=75}% less while active. ][]{$?s31223=false}[Attacks from Shadow Dance and for {$31223s1=5} sec after deal {$31665s1=10}% more damage. ][]
  • max_stacks:0
  • duration:3.00
  • cooldown:1.00
  • default_chance:0.00%
Sprint 2.7 0.0 122.3sec 122.3sec 7.21% 7.21% 86.8(86.8) 2.7

Buff details

  • buff initial source:EsdeathSAMA
  • cooldown name:buff_sprint
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • sprint_1:7.21%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2983
  • name:Sprint
  • tooltip:Movement speed increased by $w1%.
  • description:Increases your movement speed by {$s1=70}% for {$d=8 seconds}. Usable while stealthed.
  • max_stacks:0
  • duration:8.00
  • cooldown:120.00
  • default_chance:0.00%
Stealth 6.5 0.0 45.0sec 52.1sec 1.03% 1.03% 0.0(0.0) 0.0

Buff details

  • buff initial source:EsdeathSAMA
  • cooldown name:buff_stealth
  • max_stacks:1
  • duration:150.00
  • cooldown:2.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stealth_1:1.03%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:1784
  • name:Stealth
  • tooltip:Stealthed.$?$w3!=0[ Movement speed increased by $w3%.][]$?$w4!=0[ Damage increased by $w4%.][]
  • description:Conceals you in the shadows until cancelled, allowing you to stalk enemies without being seen. {$?s14062=false}[Movement speed while stealthed is increased by {$s3=0}% and damage dealt is increased by {$s4=0}%.]?s108209[ Abilities cost {$112942s1=75}% less while stealthed. ][]{$?s31223=false}[ Attacks from Stealth and for {$31223s1=5} sec after deal {$31665s1=10}% more damage.][]
  • max_stacks:0
  • duration:-0.00
  • cooldown:2.00
  • default_chance:100.00%
Subterfuge 6.6 0.0 44.6sec 52.3sec 6.56% 6.56% 0.0(0.0) 6.5

Buff details

  • buff initial source:EsdeathSAMA
  • cooldown name:buff_subterfuge
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • subterfuge_1:6.56%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:115192
  • name:Subterfuge
  • tooltip:Temporarily concealed in the shadows.
  • description:{$@spelldesc108208=Your abilities requiring Stealth can still be used for {$115192d=3 seconds} after Stealth breaks.$?c3[ Also increases the duration of Shadow Dance by ${$m2/1000} sec.][ Also causes Garrote to deal {$115192s2=125}% increased damage and have no cooldown when used from Stealth or {$115192d=3 seconds} after Stealth breaks.]}
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
Symbols of Death 1.2 12.0 183.6sec 24.0sec 99.80% 99.28% 12.0(12.0) 0.2

Buff details

  • buff initial source:EsdeathSAMA
  • cooldown name:buff_symbols_of_death
  • max_stacks:1
  • duration:35.00
  • cooldown:10.00
  • default_chance:100.00%
  • default_value:1.20

Stack Uptimes

  • symbols_of_death_1:99.80%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:212283
  • name:Symbols of Death
  • tooltip:All damage done increased by {$s1=20}%.
  • description:Invoke ancient symbols of power, increasing all damage you deal by {$s1=20}% for {$d=35 seconds}, and causing your next Shadowstrike to critically strike. Unaffected by the global cooldown.
  • max_stacks:0
  • duration:35.00
  • cooldown:10.00
  • default_chance:0.00%
Temptation 1.9 4.0 176.1sec 43.2sec 37.02% 67.21% 0.0(0.0) 1.4

Buff details

  • buff initial source:EsdeathSAMA
  • cooldown name:buff_temptation
  • max_stacks:10
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • temptation_1:9.76%
  • temptation_2:9.74%
  • temptation_3:9.51%
  • temptation_4:7.83%
  • temptation_5:0.18%
  • temptation_6:0.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:234143
  • name:Temptation
  • tooltip:Increased chance for your Ring of Collapsing Futures to incur a {$s1=5} min cooldown.
  • description:{$@spelldesc234142=Deal {$s1=40000} Shadow damage to an enemy.}
  • max_stacks:10
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Vanish 5.6 0.0 52.1sec 52.1sec 5.54% 5.54% 0.0(0.0) 5.5

Buff details

  • buff initial source:EsdeathSAMA
  • cooldown name:buff_vanish
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • vanish_1:5.54%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:11327
  • name:Vanish
  • tooltip:Improved stealth.$?$w3!=0[ Movement speed increased by $w3%.][]$?$w4!=0[ Damage increased by $w4%.][]
  • description:
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:EsdeathSAMA
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Seventh Demon

Buff details

  • buff initial source:EsdeathSAMA
  • cooldown name:buff_flask_of_the_seventh_demon
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:1300.00

Stack Uptimes

  • flask_of_the_seventh_demon_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188033
  • name:Flask of the Seventh Demon
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (seedbattered_fish_plate)

Buff details

  • buff initial source:EsdeathSAMA
  • cooldown name:buff_seedbattered_fish_plate
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:versatility_rating
  • amount:375.00

Stack Uptimes

  • seedbattered_fish_plate_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225605
  • name:Well Fed
  • tooltip:Versatility increased by $w1.
  • description:Increases versatility by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
EsdeathSAMA
backstab Energy 51.3 1795.6 35.0 35.0 4333.2
eviscerate Energy 53.1 1859.3 35.0 35.0 23620.5
eviscerate Combo Points 53.1 296.0 5.6 5.6 148390.8
nightblade Energy 17.1 426.8 25.0 25.0 72024.3
nightblade Combo Points 17.1 95.2 5.6 5.6 322967.6
shadowstrike Energy 104.4 4174.4 40.0 40.0 9453.1
symbols_of_death Energy 13.2 427.2 32.3 32.3 0.0
Resource Gains Type Count Total Average Overflow
backstab Combo Points 51.30 51.30 (13.02%) 1.00 0.00 0.00%
goremaws_bite Combo Points 4.67 13.87 (3.52%) 2.97 0.14 1.01%
shadowstrike Combo Points 104.36 208.72 (52.98%) 2.00 0.00 0.00%
energy_regen Energy 1187.09 3339.89 (38.73%) 2.81 91.02 2.65%
Shadow Techniques Combo Points 71.98 71.05 (18.03%) 0.99 15.25 17.67%
Master of Shadows Energy 37.33 788.65 (9.15%) 21.13 144.54 15.49%
Shadow Blades Combo Points 58.54 49.02 (12.44%) 0.84 9.52 16.26%
Energetic Stabbing Energy 26.05 651.21 (7.55%) 25.00 0.00 0.00%
Goremaw's Bite Energy 27.66 135.30 (1.57%) 4.89 3.02 2.18%
Relentless Strikes Energy 70.19 3081.70 (35.74%) 43.90 48.54 1.55%
Shadow Satyr's Walk Energy 104.36 626.16 (7.26%) 6.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Energy 28.62 28.82
Combo Points 1.31 1.30
Combat End Resource Mean Min Max
Energy 38.94 6.76 100.00
Combo Points 2.84 0.00 6.00

Benefits & Uptimes

Benefits %
Uptimes %
Energy Cap 1.5%

Statistics & Data Analysis

Fight Length
Sample Data EsdeathSAMA Fight Length
Count 4999
Mean 301.28
Minimum 222.03
Maximum 381.32
Spread ( max - min ) 159.29
Range [ ( max - min ) / 2 * 100% ] 26.44%
DPS
Sample Data EsdeathSAMA Damage Per Second
Count 4999
Mean 479307.10
Minimum 420866.32
Maximum 564228.69
Spread ( max - min ) 143362.38
Range [ ( max - min ) / 2 * 100% ] 14.96%
Standard Deviation 20673.7536
5th Percentile 446924.80
95th Percentile 514063.41
( 95th Percentile - 5th Percentile ) 67138.61
Mean Distribution
Standard Deviation 292.4003
95.00% Confidence Intervall ( 478734.00 - 479880.19 )
Normalized 95.00% Confidence Intervall ( 99.88% - 100.12% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 72
0.1% Error 7147
0.1 Scale Factor Error with Delta=300 3648568
0.05 Scale Factor Error with Delta=300 14594269
0.01 Scale Factor Error with Delta=300 364856713
Priority Target DPS
Sample Data EsdeathSAMA Priority Target Damage Per Second
Count 4999
Mean 479307.10
Minimum 420866.32
Maximum 564228.69
Spread ( max - min ) 143362.38
Range [ ( max - min ) / 2 * 100% ] 14.96%
Standard Deviation 20673.7536
5th Percentile 446924.80
95th Percentile 514063.41
( 95th Percentile - 5th Percentile ) 67138.61
Mean Distribution
Standard Deviation 292.4003
95.00% Confidence Intervall ( 478734.00 - 479880.19 )
Normalized 95.00% Confidence Intervall ( 99.88% - 100.12% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 72
0.1% Error 7147
0.1 Scale Factor Error with Delta=300 3648568
0.05 Scale Factor Error with Delta=300 14594269
0.01 Scale Factor Error with Delta=300 364856713
DPS(e)
Sample Data EsdeathSAMA Damage Per Second (Effective)
Count 4999
Mean 479307.10
Minimum 420866.32
Maximum 564228.69
Spread ( max - min ) 143362.38
Range [ ( max - min ) / 2 * 100% ] 14.96%
Damage
Sample Data EsdeathSAMA Damage
Count 4999
Mean 143831454.74
Minimum 108492525.37
Maximum 184737417.08
Spread ( max - min ) 76244891.71
Range [ ( max - min ) / 2 * 100% ] 26.50%
DTPS
Sample Data EsdeathSAMA Damage Taken Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data EsdeathSAMA Healing Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data EsdeathSAMA Healing Per Second (Effective)
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data EsdeathSAMA Heal
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data EsdeathSAMA Healing Taken Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data EsdeathSAMA Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data EsdeathSAMATheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data EsdeathSAMA Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,name=flask_of_the_seventh_demon
1 0.00 augmentation,name=defiled
2 0.00 food,name=seedbattered_fish_plate
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 stealth
5 0.00 potion,name=old_war
6 0.00 marked_for_death,if=raid_event.adds.in>40
7 0.00 variable,name=ssw_refund,value=equipped.shadow_satyrs_walk*(4+ssw_refund_offset)
Defined variables that doesn't change during the fight
8 0.00 variable,name=stealth_threshold,value=(15+talent.vigor.enabled*35+talent.master_of_shadows.enabled*30+variable.ssw_refund)
9 0.00 enveloping_shadows,if=combo_points>=5
A 0.00 symbols_of_death
Default action list Executed every time the actor is available.
# count action,conditions
B 0.00 call_action_list,name=cds
C 0.00 run_action_list,name=stealthed,if=stealthed.all
Fully switch to the Stealthed Rotation (by doing so, it forces pooling if nothing is available)
D 0.00 call_action_list,name=finish,if=combo_points>=5|(combo_points>=4&spell_targets.shuriken_storm>=3&spell_targets.shuriken_storm<=4)
E 0.00 call_action_list,name=stealth_als,if=combo_points.deficit>=2+talent.premeditation.enabled
F 0.00 call_action_list,name=build,if=energy.deficit<=variable.stealth_threshold
actions.build Builders
# count action,conditions
0.00 shuriken_storm,if=spell_targets.shuriken_storm>=2
0.00 gloomblade
G 51.30 backstab
actions.cds Cooldowns
# count action,conditions
H 1.00 potion,name=old_war,if=buff.bloodlust.react|target.time_to_die<=25|buff.shadow_blades.up
I 5.89 use_item,slot=finger2,if=(buff.shadow_blades.up&stealthed.rogue)|target.time_to_die<20
0.00 blood_fury,if=stealthed.rogue
0.00 berserking,if=stealthed.rogue
0.00 arcane_torrent,if=stealthed.rogue&energy.deficit>70
J 2.10 shadow_blades,if=combo_points<=2|(equipped.denial_of_the_halfgiants&combo_points>=1)
K 4.67 goremaws_bite,if=!stealthed.all&cooldown.shadow_dance.charges_fractional<=2.45&((combo_points.deficit>=4-(time<10)*2&energy.deficit>50+talent.vigor.enabled*25-(time>=10)*15)|target.time_to_die<8)
0.00 marked_for_death,target_if=min:target.time_to_die,if=target.time_to_die<combo_points.deficit|(raid_event.adds.in>40&combo_points.deficit>=4+talent.deeper_strategem.enabled+talent.anticipation.enabled)
actions.finish Finishers
# count action,conditions
0.00 enveloping_shadows,if=buff.enveloping_shadows.remains<target.time_to_die&buff.enveloping_shadows.remains<=combo_points*1.8
0.00 death_from_above,if=spell_targets.death_from_above>=6
L 17.07 nightblade,cycle_targets=1,if=target.time_to_die>8&((refreshable&(!finality|buff.finality_nightblade.up))|remains<tick_time)
0.00 death_from_above
M 53.12 eviscerate
actions.stealth_cds Stealth Cooldowns
# count action,conditions
R 3.65 shadow_dance,if=charges_fractional>=2.45
S 2.85 vanish
T 2.74 sprint_offensive
U 4.55 shadow_dance,if=charges>=2&combo_points<=1
0.00 pool_resource,for_next=1,extra_amount=40
0.00 shadowmeld,if=energy>=40&energy.deficit>=10+variable.ssw_refund
V 18.01 shadow_dance,if=combo_points<=1
actions.stealthed Stealthed Rotation
# count action,conditions
W 12.21 symbols_of_death,if=(buff.symbols_of_death.remains<target.time_to_die-4&buff.symbols_of_death.remains<=buff.symbols_of_death.duration*0.3)|equipped.shadow_satyrs_walk&energy.time_to_max<0.25
X 0.00 call_action_list,name=finish,if=combo_points>=5
0.00 shuriken_storm,if=buff.shadowmeld.down&((combo_points.deficit>=3&spell_targets.shuriken_storm>=2+talent.premeditation.enabled+equipped.shadow_satyrs_walk)|buff.the_dreadlords_deceit.stack>=29)
Y 104.36 shadowstrike

Sample Sequence

0124578AJIYYLRYYMYYMSYYMRWYYLIYYMKGMRWYMYYMTUYYMYYMGGMGGLRWYYMYYMUYYMYYLUYYMWYYMUYYMYGMVYYYLVYYMWYYMKGMVYYYLYGMGGGMVYYYMYGLGGGMVWYYLGSYMYGGMVYYYMGKLVWYYMYYGMTGYYLVWYYMYGGMGGGJHLVYYMYYMGGMVWYYLYMGGMVYYMWYYMKGMVYLYYMGGMVYYMYGLGGMVYYMYGGLVWYYYMYSYMYGGMVYYLYYGMGGKMVYYMWYTGYMYGGMVWYYMYG

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask EsdeathSAMA 100.0/100: 100% energy | 0.0/6: 0% combo_points
Pre precombat 1 augmentation EsdeathSAMA 100.0/100: 100% energy | 0.0/6: 0% combo_points
Pre precombat 2 food EsdeathSAMA 100.0/100: 100% energy | 0.0/6: 0% combo_points
Pre precombat 4 stealth Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, stealth
Pre precombat 5 potion Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, stealth, potion_of_the_old_war
Pre precombat 7 ssw_refund Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, stealth, potion_of_the_old_war
Pre precombat 8 stealth_threshold Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, stealth, potion_of_the_old_war
Pre precombat A symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, stealth, symbols_of_death, death, potion_of_the_old_war
0:00.000 cds J shadow_blades Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, stealth, symbols_of_death, death, potion_of_the_old_war
0:00.000 cds I use_item_ring_of_collapsing_futures Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, stealth, symbols_of_death, shadow_blades, death, potion_of_the_old_war
0:00.000 stealthed Y shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points temptation, master_of_subtlety_aura, stealth, symbols_of_death, shadow_blades, death, potion_of_the_old_war
0:01.004 stealthed Y shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 3.0/6: 50% combo_points bloodlust, temptation, master_of_subtlety_aura, stealth, subterfuge, symbols_of_death, shadow_blades, potion_of_the_old_war
0:02.008 finish L nightblade Fluffy_Pillow 80.3/100: 80% energy | 6.0/6: 100% combo_points bloodlust, temptation, master_of_subtlety_aura, stealth, subterfuge, symbols_of_death, shadow_blades, potion_of_the_old_war
0:03.013 stealth_cds R shadow_dance Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points bloodlust, temptation, master_of_subtlety, symbols_of_death, shadow_blades, finality_nightblade(6), potion_of_the_old_war
0:03.013 stealthed Y shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points bloodlust, temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6), potion_of_the_old_war
0:04.016 stealthed Y shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 3.0/6: 50% combo_points bloodlust, temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6), potion_of_the_old_war
0:05.021 finish M eviscerate Fluffy_Pillow 80.3/100: 80% energy | 6.0/6: 100% combo_points bloodlust, temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6), potion_of_the_old_war
0:06.026 stealthed Y shadowstrike Fluffy_Pillow 99.6/100: 100% energy | 0.0/6: 0% combo_points bloodlust, temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6), potion_of_the_old_war
0:07.031 stealthed Y shadowstrike Fluffy_Pillow 79.9/100: 80% energy | 4.0/6: 67% combo_points bloodlust, temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6), potion_of_the_old_war
0:08.037 finish M eviscerate Fluffy_Pillow 60.3/100: 60% energy | 6.0/6: 100% combo_points bloodlust, temptation, master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6), potion_of_the_old_war
0:09.042 stealth_cds S vanish Fluffy_Pillow 79.6/100: 80% energy | 0.0/6: 0% combo_points bloodlust, temptation, master_of_subtlety, symbols_of_death, shadow_blades, finality_nightblade(6), potion_of_the_old_war
0:09.042 stealthed Y shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points bloodlust, temptation, master_of_subtlety_aura, vanish, symbols_of_death, shadow_blades, finality_nightblade(6), potion_of_the_old_war
0:10.046 stealthed Y shadowstrike Fluffy_Pillow 80.3/100: 80% energy | 3.0/6: 50% combo_points bloodlust, temptation, master_of_subtlety_aura, vanish, subterfuge, symbols_of_death, shadow_blades, finality_nightblade(6), potion_of_the_old_war
0:11.050 finish M eviscerate Fluffy_Pillow 60.6/100: 61% energy | 6.0/6: 100% combo_points bloodlust, temptation, master_of_subtlety_aura, vanish, subterfuge, symbols_of_death, shadow_blades, finality_nightblade(6), potion_of_the_old_war
0:12.055 stealth_cds R shadow_dance Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points bloodlust, temptation, master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6), potion_of_the_old_war
0:12.055 stealthed W symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points bloodlust, temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6), potion_of_the_old_war
0:12.055 stealthed Y shadowstrike Fluffy_Pillow 65.0/100: 65% energy | 0.0/6: 0% combo_points bloodlust, temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, death, finality_eviscerate(6), finality_nightblade(6), potion_of_the_old_war
0:13.060 stealthed Y shadowstrike Fluffy_Pillow 45.3/100: 45% energy | 4.0/6: 67% combo_points bloodlust, temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6), potion_of_the_old_war
0:14.065 Waiting     0.600 sec 25.6/100: 26% energy | 6.0/6: 100% combo_points bloodlust, temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6), potion_of_the_old_war
0:14.665 finish L nightblade Fluffy_Pillow 34.2/100: 34% energy | 6.0/6: 100% combo_points bloodlust, temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6), potion_of_the_old_war
0:15.671 cds I use_item_ring_of_collapsing_futures Fluffy_Pillow 63.5/100: 63% energy | 1.0/6: 17% combo_points bloodlust, temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), potion_of_the_old_war
0:15.671 stealthed Y shadowstrike Fluffy_Pillow 63.5/100: 63% energy | 1.0/6: 17% combo_points bloodlust, temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), potion_of_the_old_war
0:16.677 stealthed Y shadowstrike Fluffy_Pillow 43.8/100: 44% energy | 4.0/6: 67% combo_points bloodlust, temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), potion_of_the_old_war
0:17.681 Waiting     0.800 sec 24.1/100: 24% energy | 6.0/6: 100% combo_points bloodlust, temptation(2), master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), potion_of_the_old_war
0:18.481 finish M eviscerate Fluffy_Pillow 35.5/100: 36% energy | 6.0/6: 100% combo_points bloodlust, temptation(2), master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), potion_of_the_old_war
0:19.485 cds K goremaws_bite Fluffy_Pillow 54.8/100: 55% energy | 1.0/6: 17% combo_points bloodlust, temptation(2), master_of_subtlety, symbols_of_death, shadow_blades, potion_of_the_old_war
0:20.489 build G backstab Fluffy_Pillow 74.1/100: 74% energy | 4.0/6: 67% combo_points bloodlust, temptation(2), master_of_subtlety, symbols_of_death, shadow_blades, goremaws_bite, potion_of_the_old_war
0:21.492 finish M eviscerate Fluffy_Pillow 58.4/100: 58% energy | 6.0/6: 100% combo_points bloodlust, temptation(2), master_of_subtlety, symbols_of_death, shadow_blades, goremaws_bite, potion_of_the_old_war
0:22.497 stealth_cds R shadow_dance Fluffy_Pillow 82.7/100: 83% energy | 2.0/6: 33% combo_points bloodlust, temptation(2), symbols_of_death, shadow_blades, goremaws_bite, finality_eviscerate(6), potion_of_the_old_war
0:22.497 stealthed W symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 2.0/6: 33% combo_points bloodlust, temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, goremaws_bite, finality_eviscerate(6), potion_of_the_old_war
0:22.497 stealthed Y shadowstrike Fluffy_Pillow 65.0/100: 65% energy | 2.0/6: 33% combo_points bloodlust, temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, goremaws_bite, death, finality_eviscerate(6), potion_of_the_old_war
0:23.502 finish M eviscerate Fluffy_Pillow 50.3/100: 50% energy | 5.0/6: 83% combo_points bloodlust, temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, goremaws_bite, finality_eviscerate(6)
0:24.506 stealthed Y shadowstrike Fluffy_Pillow 74.6/100: 75% energy | 0.0/6: 0% combo_points bloodlust, temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, goremaws_bite
0:25.510 stealthed Y shadowstrike Fluffy_Pillow 59.9/100: 60% energy | 4.0/6: 67% combo_points bloodlust, temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades
0:26.515 finish M eviscerate Fluffy_Pillow 40.2/100: 40% energy | 6.0/6: 100% combo_points bloodlust, temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades
0:27.520 stealth_cds T sprint Fluffy_Pillow 59.5/100: 60% energy | 0.0/6: 0% combo_points bloodlust, temptation(2), master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6)
0:27.520 stealth_cds U shadow_dance Fluffy_Pillow 59.5/100: 60% energy | 0.0/6: 0% combo_points bloodlust, temptation(2), master_of_subtlety, sprint, symbols_of_death, shadow_blades, finality_eviscerate(6), faster_than_light_trigger
0:27.520 stealthed Y shadowstrike Fluffy_Pillow 84.5/100: 85% energy | 0.0/6: 0% combo_points bloodlust, temptation(2), master_of_subtlety_aura, shadow_dance, sprint, symbols_of_death, shadow_blades, finality_eviscerate(6), faster_than_light_trigger
0:28.524 stealthed Y shadowstrike Fluffy_Pillow 64.8/100: 65% energy | 3.0/6: 50% combo_points bloodlust, temptation(2), master_of_subtlety_aura, shadow_dance, sprint, symbols_of_death, shadow_blades, finality_eviscerate(6), faster_than_light_trigger
0:29.529 finish M eviscerate Fluffy_Pillow 70.1/100: 70% energy | 6.0/6: 100% combo_points bloodlust, temptation(2), master_of_subtlety_aura, shadow_dance, sprint, symbols_of_death, shadow_blades, finality_eviscerate(6), faster_than_light_trigger
0:30.535 stealthed Y shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points bloodlust, temptation(2), master_of_subtlety_aura, shadow_dance, vanish, subterfuge, sprint, symbols_of_death, shadow_blades
0:31.539 stealthed Y shadowstrike Fluffy_Pillow 80.3/100: 80% energy | 4.0/6: 67% combo_points bloodlust, temptation(2), master_of_subtlety_aura, shadow_dance, vanish, subterfuge, sprint, symbols_of_death, shadow_blades
0:32.545 finish M eviscerate Fluffy_Pillow 60.6/100: 61% energy | 6.0/6: 100% combo_points bloodlust, temptation(2), master_of_subtlety, vanish, subterfuge, sprint, symbols_of_death, shadow_blades
0:33.550 build G backstab Fluffy_Pillow 100.0/100: 100% energy | 2.0/6: 33% combo_points bloodlust, temptation(2), master_of_subtlety, sprint, symbols_of_death, shadow_blades, finality_eviscerate(6)
0:34.554 build G backstab Fluffy_Pillow 79.3/100: 79% energy | 4.0/6: 67% combo_points bloodlust, temptation(2), master_of_subtlety, sprint, symbols_of_death, shadow_blades, finality_eviscerate(6)
0:35.559 finish M eviscerate Fluffy_Pillow 58.6/100: 59% energy | 6.0/6: 100% combo_points bloodlust, temptation(2), master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6)
0:36.565 build G backstab Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points bloodlust, temptation(2), master_of_subtlety, symbols_of_death, shadow_blades
0:37.570 build G backstab Fluffy_Pillow 79.3/100: 79% energy | 3.0/6: 50% combo_points bloodlust, temptation(2), master_of_subtlety, symbols_of_death, shadow_blades
0:38.576 finish L nightblade Fluffy_Pillow 58.6/100: 59% energy | 6.0/6: 100% combo_points bloodlust, temptation(2), symbols_of_death, shadow_blades
0:39.581 stealth_cds R shadow_dance Fluffy_Pillow 88.0/100: 88% energy | 0.0/6: 0% combo_points bloodlust, temptation(2), symbols_of_death, shadow_blades, finality_nightblade(6)
0:39.581 stealthed W symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points bloodlust, temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6)
0:39.581 stealthed Y shadowstrike Fluffy_Pillow 65.0/100: 65% energy | 0.0/6: 0% combo_points bloodlust, temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, death, finality_nightblade(6)
0:40.585 stealthed Y shadowstrike Fluffy_Pillow 45.3/100: 45% energy | 3.0/6: 50% combo_points bloodlust, temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6)
0:41.590 finish M eviscerate Fluffy_Pillow 47.4/100: 47% energy | 6.0/6: 100% combo_points temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6)
0:42.596 stealthed Y shadowstrike Fluffy_Pillow 63.5/100: 63% energy | 1.0/6: 17% combo_points temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6)
0:43.599 stealthed Y shadowstrike Fluffy_Pillow 40.4/100: 40% energy | 4.0/6: 67% combo_points temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6)
0:44.603 Waiting     1.689 sec 17.4/100: 17% energy | 6.0/6: 100% combo_points temptation(2), master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6)
0:46.292 finish M eviscerate Fluffy_Pillow 35.9/100: 36% energy | 6.0/6: 100% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6)
0:47.295 stealth_cds U shadow_dance Fluffy_Pillow 51.9/100: 52% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_nightblade(6)
0:47.295 stealthed Y shadowstrike Fluffy_Pillow 76.9/100: 77% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6)
0:48.300 stealthed Y shadowstrike Fluffy_Pillow 53.9/100: 54% energy | 3.0/6: 50% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6)
0:49.305 Waiting     0.400 sec 31.0/100: 31% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6)
0:49.705 finish M eviscerate Fluffy_Pillow 35.3/100: 35% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6)
0:50.710 stealthed Y shadowstrike Fluffy_Pillow 91.3/100: 91% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6)
0:51.715 stealthed Y shadowstrike Fluffy_Pillow 68.4/100: 68% energy | 3.0/6: 50% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6)
0:52.721 finish L nightblade Fluffy_Pillow 45.4/100: 45% energy | 6.0/6: 100% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6)
0:53.723 stealth_cds U shadow_dance Fluffy_Pillow 71.4/100: 71% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6)
0:53.723 stealthed Y shadowstrike Fluffy_Pillow 96.4/100: 96% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6)
0:54.728 stealthed Y shadowstrike Fluffy_Pillow 73.4/100: 73% energy | 3.0/6: 50% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6)
0:55.734 finish M eviscerate Fluffy_Pillow 75.4/100: 75% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6)
0:56.739 stealthed W symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
0:56.739 stealthed Y shadowstrike Fluffy_Pillow 65.0/100: 65% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, death
0:57.745 stealthed Y shadowstrike Fluffy_Pillow 42.0/100: 42% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
0:58.749 Waiting     1.545 sec 19.0/100: 19% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death
1:00.294 finish M eviscerate Fluffy_Pillow 35.9/100: 36% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death
1:01.298 stealth_cds U shadow_dance Fluffy_Pillow 51.9/100: 52% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5)
1:01.298 stealthed Y shadowstrike Fluffy_Pillow 76.9/100: 77% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5)
1:02.304 stealthed Y shadowstrike Fluffy_Pillow 54.0/100: 54% energy | 3.0/6: 50% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5)
1:03.309 Waiting     0.400 sec 31.0/100: 31% energy | 5.0/6: 83% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5)
1:03.709 finish M eviscerate Fluffy_Pillow 35.4/100: 35% energy | 5.0/6: 83% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5)
1:04.714 stealthed Y shadowstrike Fluffy_Pillow 51.4/100: 51% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
1:05.718 Waiting     2.100 sec 28.4/100: 28% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
1:07.818 build G backstab Fluffy_Pillow 51.4/100: 51% energy | 3.0/6: 50% combo_points master_of_subtlety, symbols_of_death
1:08.822 Waiting     1.300 sec 27.4/100: 27% energy | 4.0/6: 67% combo_points master_of_subtlety, symbols_of_death
1:10.122 finish M eviscerate Fluffy_Pillow 41.6/100: 42% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death
1:11.125 stealth_cds V shadow_dance Fluffy_Pillow 57.6/100: 58% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5)
1:11.125 stealthed Y shadowstrike Fluffy_Pillow 82.6/100: 83% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5)
1:12.129 stealthed Y shadowstrike Fluffy_Pillow 59.6/100: 60% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5)
1:13.135 Waiting     0.400 sec 36.6/100: 37% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5)
1:13.535 stealthed Y shadowstrike Fluffy_Pillow 41.0/100: 41% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5)
1:14.539 Waiting     0.739 sec 18.0/100: 18% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5)
1:15.278 finish L nightblade Fluffy_Pillow 26.1/100: 26% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5)
1:16.283 stealth_cds V shadow_dance Fluffy_Pillow 52.1/100: 52% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5), finality_nightblade(6)
1:16.283 stealthed Y shadowstrike Fluffy_Pillow 77.1/100: 77% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5), finality_nightblade(6)
1:17.286 stealthed Y shadowstrike Fluffy_Pillow 54.1/100: 54% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5), finality_nightblade(6)
1:18.290 finish M eviscerate Fluffy_Pillow 56.1/100: 56% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5), finality_nightblade(6)
1:19.294 stealthed W symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(6)
1:19.294 stealthed Y shadowstrike Fluffy_Pillow 65.0/100: 65% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, death, finality_nightblade(6)
1:20.297 stealthed Y shadowstrike Fluffy_Pillow 42.0/100: 42% energy | 3.0/6: 50% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(6)
1:21.302 Waiting     1.547 sec 19.0/100: 19% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death, finality_nightblade(6)
1:22.849 finish M eviscerate Fluffy_Pillow 35.9/100: 36% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death, finality_nightblade(6)
1:23.855 cds K goremaws_bite Fluffy_Pillow 52.0/100: 52% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5), finality_nightblade(6)
1:24.859 build G backstab Fluffy_Pillow 68.0/100: 68% energy | 3.0/6: 50% combo_points master_of_subtlety, symbols_of_death, goremaws_bite, finality_eviscerate(5), finality_nightblade(6)
1:25.865 finish M eviscerate Fluffy_Pillow 49.0/100: 49% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death, goremaws_bite, finality_eviscerate(5), finality_nightblade(6)
1:26.868 stealth_cds V shadow_dance Fluffy_Pillow 70.0/100: 70% energy | 0.0/6: 0% combo_points symbols_of_death, goremaws_bite, finality_nightblade(6)
1:26.868 stealthed Y shadowstrike Fluffy_Pillow 95.0/100: 95% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, goremaws_bite, finality_nightblade(6)
1:27.873 stealthed Y shadowstrike Fluffy_Pillow 77.0/100: 77% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, goremaws_bite, finality_nightblade(6)
1:28.878 stealthed Y shadowstrike Fluffy_Pillow 59.0/100: 59% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, goremaws_bite, finality_nightblade(6)
1:29.882 finish L nightblade Fluffy_Pillow 41.0/100: 41% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(6)
1:30.887 stealthed Y shadowstrike Fluffy_Pillow 67.0/100: 67% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
1:31.893 Waiting     0.700 sec 44.0/100: 44% energy | 2.0/6: 33% combo_points master_of_subtlety, symbols_of_death
1:32.593 build G backstab Fluffy_Pillow 51.7/100: 52% energy | 2.0/6: 33% combo_points master_of_subtlety, symbols_of_death
1:33.598 Waiting     1.200 sec 27.7/100: 28% energy | 3.0/6: 50% combo_points master_of_subtlety, symbols_of_death
1:34.798 finish M eviscerate Fluffy_Pillow 40.8/100: 41% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death
1:35.805 build G backstab Fluffy_Pillow 56.9/100: 57% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5)
1:36.809 Waiting     1.700 sec 32.9/100: 33% energy | 1.0/6: 17% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5)
1:38.509 build G backstab Fluffy_Pillow 51.5/100: 51% energy | 2.0/6: 33% combo_points symbols_of_death, finality_eviscerate(5)
1:39.513 Waiting     2.200 sec 27.5/100: 27% energy | 3.0/6: 50% combo_points symbols_of_death, finality_eviscerate(5)
1:41.713 build G backstab Fluffy_Pillow 51.6/100: 52% energy | 3.0/6: 50% combo_points symbols_of_death, finality_eviscerate(5)
1:42.718 Waiting     0.700 sec 27.6/100: 28% energy | 4.0/6: 67% combo_points symbols_of_death, finality_eviscerate(5)
1:43.418 finish M eviscerate Fluffy_Pillow 35.3/100: 35% energy | 5.0/6: 83% combo_points symbols_of_death, finality_eviscerate(5)
1:44.421 stealth_cds V shadow_dance Fluffy_Pillow 51.3/100: 51% energy | 0.0/6: 0% combo_points symbols_of_death
1:44.421 stealthed Y shadowstrike Fluffy_Pillow 76.3/100: 76% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
1:45.427 stealthed Y shadowstrike Fluffy_Pillow 78.3/100: 78% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
1:46.431 stealthed Y shadowstrike Fluffy_Pillow 55.3/100: 55% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
1:47.437 Waiting     0.300 sec 32.3/100: 32% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
1:47.737 finish M eviscerate Fluffy_Pillow 35.6/100: 36% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
1:48.743 stealthed Y shadowstrike Fluffy_Pillow 51.6/100: 52% energy | 1.0/6: 17% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6)
1:49.748 Waiting     2.100 sec 28.6/100: 29% energy | 3.0/6: 50% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(6)
1:51.848 build G backstab Fluffy_Pillow 51.6/100: 52% energy | 4.0/6: 67% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(6)
1:52.852 finish L nightblade Fluffy_Pillow 27.6/100: 28% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(6)
1:53.857 build G backstab Fluffy_Pillow 53.6/100: 54% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(6), finality_nightblade(5)
1:54.861 Waiting     2.000 sec 29.6/100: 30% energy | 1.0/6: 17% combo_points symbols_of_death, finality_eviscerate(6), finality_nightblade(5)
1:56.861 build G backstab Fluffy_Pillow 51.5/100: 52% energy | 2.0/6: 33% combo_points symbols_of_death, finality_eviscerate(6), finality_nightblade(5)
1:57.865 Waiting     2.200 sec 27.5/100: 28% energy | 3.0/6: 50% combo_points symbols_of_death, finality_eviscerate(6), finality_nightblade(5)
2:00.065 build G backstab Fluffy_Pillow 51.6/100: 52% energy | 4.0/6: 67% combo_points symbols_of_death, finality_eviscerate(6), finality_nightblade(5)
2:01.069 Waiting     0.700 sec 27.6/100: 28% energy | 5.0/6: 83% combo_points symbols_of_death, finality_eviscerate(6), finality_nightblade(5)
2:01.769 finish M eviscerate Fluffy_Pillow 35.3/100: 35% energy | 5.0/6: 83% combo_points symbols_of_death, finality_eviscerate(6), finality_nightblade(5)
2:02.772 stealth_cds V shadow_dance Fluffy_Pillow 51.3/100: 51% energy | 0.0/6: 0% combo_points symbols_of_death, finality_nightblade(5)
2:02.772 stealthed W symbols_of_death Fluffy_Pillow 76.3/100: 76% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(5)
2:02.772 stealthed Y shadowstrike Fluffy_Pillow 41.3/100: 41% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, death, finality_nightblade(5)
2:03.775 Waiting     2.012 sec 18.3/100: 18% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(5)
2:05.787 stealthed Y shadowstrike Fluffy_Pillow 40.3/100: 40% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(5)
2:06.790 Waiting     0.801 sec 17.3/100: 17% energy | 5.0/6: 83% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(5)
2:07.591 finish L nightblade Fluffy_Pillow 26.1/100: 26% energy | 5.0/6: 83% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(5)
2:08.597 build G backstab Fluffy_Pillow 52.1/100: 52% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death
2:09.600 Waiting     2.100 sec 28.1/100: 28% energy | 2.0/6: 33% combo_points master_of_subtlety, symbols_of_death
2:11.700 stealth_cds S vanish Fluffy_Pillow 51.1/100: 51% energy | 2.0/6: 33% combo_points master_of_subtlety, symbols_of_death
2:11.700 stealthed Y shadowstrike Fluffy_Pillow 76.1/100: 76% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, vanish, symbols_of_death
2:12.705 finish M eviscerate Fluffy_Pillow 53.1/100: 53% energy | 5.0/6: 83% combo_points master_of_subtlety_aura, vanish, subterfuge, symbols_of_death
2:13.709 stealthed Y shadowstrike Fluffy_Pillow 69.1/100: 69% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, vanish, subterfuge, symbols_of_death, finality_eviscerate(5)
2:14.715 build G backstab Fluffy_Pillow 96.1/100: 96% energy | 2.0/6: 33% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5)
2:15.720 build G backstab Fluffy_Pillow 72.1/100: 72% energy | 3.0/6: 50% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5)
2:16.723 finish M eviscerate Fluffy_Pillow 48.1/100: 48% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5)
2:17.729 stealth_cds V shadow_dance Fluffy_Pillow 64.2/100: 64% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death
2:17.729 stealthed Y shadowstrike Fluffy_Pillow 89.2/100: 89% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
2:18.733 stealthed Y shadowstrike Fluffy_Pillow 66.2/100: 66% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
2:19.738 stealthed Y shadowstrike Fluffy_Pillow 43.2/100: 43% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
2:20.744 Waiting     1.439 sec 20.2/100: 20% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
2:22.183 finish M eviscerate Fluffy_Pillow 35.9/100: 36% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
2:23.189 build G backstab Fluffy_Pillow 52.0/100: 52% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(6)
2:24.194 cds K goremaws_bite Fluffy_Pillow 28.0/100: 28% energy | 2.0/6: 33% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(6)
2:25.196 finish L nightblade Fluffy_Pillow 44.0/100: 44% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death, goremaws_bite, finality_eviscerate(6)
2:26.200 stealth_cds V shadow_dance Fluffy_Pillow 75.0/100: 75% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, goremaws_bite, finality_eviscerate(6), finality_nightblade(5)
2:26.200 stealthed W symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, goremaws_bite, finality_eviscerate(6), finality_nightblade(5)
2:26.200 stealthed Y shadowstrike Fluffy_Pillow 65.0/100: 65% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, goremaws_bite, death, finality_eviscerate(6), finality_nightblade(5)
2:27.205 stealthed Y shadowstrike Fluffy_Pillow 47.0/100: 47% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, goremaws_bite, finality_eviscerate(6), finality_nightblade(5)
2:28.208 Waiting     0.800 sec 28.9/100: 29% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, goremaws_bite, finality_eviscerate(6), finality_nightblade(5)
2:29.008 finish M eviscerate Fluffy_Pillow 37.7/100: 38% energy | 5.0/6: 83% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, goremaws_bite, finality_eviscerate(6), finality_nightblade(5)
2:30.012 stealthed Y shadowstrike Fluffy_Pillow 58.7/100: 59% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, goremaws_bite, finality_nightblade(5)
2:31.018 stealthed Y shadowstrike Fluffy_Pillow 65.7/100: 66% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(5)
2:32.024 Waiting     0.800 sec 42.8/100: 43% energy | 4.0/6: 67% combo_points master_of_subtlety, symbols_of_death, finality_nightblade(5)
2:32.824 build G backstab Fluffy_Pillow 51.5/100: 52% energy | 4.0/6: 67% combo_points master_of_subtlety, symbols_of_death, finality_nightblade(5)
2:33.828 Waiting     0.700 sec 27.5/100: 28% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death, finality_nightblade(5)
2:34.528 finish M eviscerate Fluffy_Pillow 35.2/100: 35% energy | 6.0/6: 100% combo_points master_of_subtlety, symbols_of_death, finality_nightblade(5)
2:35.533 stealth_cds T sprint Fluffy_Pillow 51.2/100: 51% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(6), finality_nightblade(5)
2:35.533 build G backstab Fluffy_Pillow 51.2/100: 51% energy | 0.0/6: 0% combo_points master_of_subtlety, sprint, symbols_of_death, finality_eviscerate(6), finality_nightblade(5), faster_than_light_trigger
2:36.538 Waiting     2.000 sec 27.2/100: 27% energy | 1.0/6: 17% combo_points sprint, symbols_of_death, finality_eviscerate(6), finality_nightblade(5), faster_than_light_trigger
2:38.538 stealthed Y shadowstrike Fluffy_Pillow 74.1/100: 74% energy | 1.0/6: 17% combo_points master_of_subtlety_aura, vanish, subterfuge, sprint, symbols_of_death, finality_eviscerate(6), finality_nightblade(5)
2:39.542 stealthed Y shadowstrike Fluffy_Pillow 51.1/100: 51% energy | 3.0/6: 50% combo_points master_of_subtlety_aura, vanish, subterfuge, sprint, symbols_of_death, finality_eviscerate(6), finality_nightblade(5)
2:40.548 finish L nightblade Fluffy_Pillow 28.1/100: 28% energy | 5.0/6: 83% combo_points master_of_subtlety_aura, vanish, subterfuge, sprint, symbols_of_death, finality_eviscerate(6), finality_nightblade(5)
2:41.554 stealth_cds V shadow_dance Fluffy_Pillow 79.2/100: 79% energy | 0.0/6: 0% combo_points master_of_subtlety, sprint, symbols_of_death, finality_eviscerate(6)
2:41.554 stealthed W symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, sprint, symbols_of_death, finality_eviscerate(6)
2:41.554 stealthed Y shadowstrike Fluffy_Pillow 65.0/100: 65% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, sprint, symbols_of_death, death, finality_eviscerate(6)
2:42.558 stealthed Y shadowstrike Fluffy_Pillow 42.0/100: 42% energy | 3.0/6: 50% combo_points master_of_subtlety_aura, shadow_dance, sprint, symbols_of_death, finality_eviscerate(6)
2:43.563 Waiting     1.546 sec 19.0/100: 19% energy | 5.0/6: 83% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6)
2:45.109 finish M eviscerate Fluffy_Pillow 35.9/100: 36% energy | 5.0/6: 83% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6)
2:46.114 stealthed Y shadowstrike Fluffy_Pillow 52.0/100: 52% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
2:47.118 build G backstab Fluffy_Pillow 54.0/100: 54% energy | 2.0/6: 33% combo_points master_of_subtlety, symbols_of_death
2:48.123 Waiting     2.000 sec 30.0/100: 30% energy | 3.0/6: 50% combo_points master_of_subtlety, symbols_of_death
2:50.123 build G backstab Fluffy_Pillow 51.9/100: 52% energy | 4.0/6: 67% combo_points master_of_subtlety, symbols_of_death
2:51.127 Waiting     0.700 sec 27.9/100: 28% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death
2:51.827 finish M eviscerate Fluffy_Pillow 35.5/100: 36% energy | 6.0/6: 100% combo_points symbols_of_death
2:52.832 build G backstab Fluffy_Pillow 51.5/100: 52% energy | 0.0/6: 0% combo_points symbols_of_death, finality_eviscerate(6)
2:53.836 Waiting     2.200 sec 27.5/100: 28% energy | 1.0/6: 17% combo_points symbols_of_death, finality_eviscerate(6)
2:56.036 build G backstab Fluffy_Pillow 51.6/100: 52% energy | 1.0/6: 17% combo_points symbols_of_death, finality_eviscerate(6)
2:57.041 Waiting     2.200 sec 27.7/100: 28% energy | 3.0/6: 50% combo_points symbols_of_death, finality_eviscerate(6)
2:59.241 build G backstab Fluffy_Pillow 51.8/100: 52% energy | 3.0/6: 50% combo_points symbols_of_death, finality_eviscerate(6)
3:00.247 cds J shadow_blades Fluffy_Pillow 27.8/100: 28% energy | 5.0/6: 83% combo_points symbols_of_death, finality_eviscerate(6)
3:00.247 cds H potion Fluffy_Pillow 27.8/100: 28% energy | 5.0/6: 83% combo_points symbols_of_death, shadow_blades, finality_eviscerate(6)
3:00.247 finish L nightblade Fluffy_Pillow 27.8/100: 28% energy | 5.0/6: 83% combo_points symbols_of_death, shadow_blades, finality_eviscerate(6), potion_of_the_old_war
3:01.251 stealth_cds V shadow_dance Fluffy_Pillow 53.8/100: 54% energy | 0.0/6: 0% combo_points symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(5), potion_of_the_old_war
3:01.251 stealthed Y shadowstrike Fluffy_Pillow 78.8/100: 79% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(5), potion_of_the_old_war
3:02.254 stealthed Y shadowstrike Fluffy_Pillow 80.8/100: 81% energy | 3.0/6: 50% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(5), potion_of_the_old_war
3:03.259 finish M eviscerate Fluffy_Pillow 57.8/100: 58% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(5), potion_of_the_old_war
3:04.264 stealthed Y shadowstrike Fluffy_Pillow 73.8/100: 74% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(5), potion_of_the_old_war
3:05.270 stealthed Y shadowstrike Fluffy_Pillow 75.8/100: 76% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(5), potion_of_the_old_war
3:06.276 finish M eviscerate Fluffy_Pillow 52.8/100: 53% energy | 6.0/6: 100% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_nightblade(5), potion_of_the_old_war
3:07.281 build G backstab Fluffy_Pillow 68.8/100: 69% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(5), potion_of_the_old_war
3:08.287 Waiting     0.600 sec 44.9/100: 45% energy | 4.0/6: 67% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(5), potion_of_the_old_war
3:08.887 build G backstab Fluffy_Pillow 51.4/100: 51% energy | 4.0/6: 67% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(5), potion_of_the_old_war
3:09.891 Waiting     0.700 sec 27.4/100: 27% energy | 6.0/6: 100% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(5), potion_of_the_old_war
3:10.591 finish M eviscerate Fluffy_Pillow 35.1/100: 35% energy | 6.0/6: 100% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(5), potion_of_the_old_war
3:11.597 stealth_cds V shadow_dance Fluffy_Pillow 91.1/100: 91% energy | 1.0/6: 17% combo_points symbols_of_death, shadow_blades, finality_nightblade(5), potion_of_the_old_war
3:11.597 stealthed W symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(5), potion_of_the_old_war
3:11.597 stealthed Y shadowstrike Fluffy_Pillow 65.0/100: 65% energy | 1.0/6: 17% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, death, finality_nightblade(5), potion_of_the_old_war
3:12.601 stealthed Y shadowstrike Fluffy_Pillow 42.0/100: 42% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(5), potion_of_the_old_war
3:13.605 finish L nightblade Fluffy_Pillow 44.0/100: 44% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(5), potion_of_the_old_war
3:14.610 stealthed Y shadowstrike Fluffy_Pillow 70.0/100: 70% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, potion_of_the_old_war
3:15.614 finish M eviscerate Fluffy_Pillow 47.0/100: 47% energy | 5.0/6: 83% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, potion_of_the_old_war
3:16.619 build G backstab Fluffy_Pillow 63.0/100: 63% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(5), potion_of_the_old_war
3:17.623 Waiting     1.100 sec 39.0/100: 39% energy | 2.0/6: 33% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(5), potion_of_the_old_war
3:18.723 build G backstab Fluffy_Pillow 51.1/100: 51% energy | 3.0/6: 50% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(5), potion_of_the_old_war
3:19.728 Waiting     0.800 sec 27.1/100: 27% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(5), potion_of_the_old_war
3:20.528 finish M eviscerate Fluffy_Pillow 35.8/100: 36% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(5), potion_of_the_old_war
3:21.532 stealth_cds V shadow_dance Fluffy_Pillow 51.8/100: 52% energy | 1.0/6: 17% combo_points master_of_subtlety, symbols_of_death, shadow_blades, potion_of_the_old_war
3:21.532 stealthed Y shadowstrike Fluffy_Pillow 76.8/100: 77% energy | 1.0/6: 17% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, potion_of_the_old_war
3:22.534 stealthed Y shadowstrike Fluffy_Pillow 78.8/100: 79% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, potion_of_the_old_war
3:23.539 finish M eviscerate Fluffy_Pillow 80.8/100: 81% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, potion_of_the_old_war
3:24.545 stealthed W symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), potion_of_the_old_war
3:24.545 stealthed Y shadowstrike Fluffy_Pillow 65.0/100: 65% energy | 1.0/6: 17% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, death, finality_eviscerate(6), potion_of_the_old_war
3:25.547 stealthed Y shadowstrike Fluffy_Pillow 42.0/100: 42% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6)
3:26.551 Waiting     1.549 sec 19.0/100: 19% energy | 6.0/6: 100% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6)
3:28.100 finish M eviscerate Fluffy_Pillow 35.9/100: 36% energy | 6.0/6: 100% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6)
3:29.103 cds K goremaws_bite Fluffy_Pillow 51.9/100: 52% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, shadow_blades
3:30.108 build G backstab Fluffy_Pillow 67.9/100: 68% energy | 3.0/6: 50% combo_points master_of_subtlety, symbols_of_death, shadow_blades, goremaws_bite
3:31.115 finish M eviscerate Fluffy_Pillow 49.0/100: 49% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death, shadow_blades, goremaws_bite
3:32.121 stealth_cds V shadow_dance Fluffy_Pillow 70.0/100: 70% energy | 0.0/6: 0% combo_points symbols_of_death, shadow_blades, goremaws_bite, finality_eviscerate(5)
3:32.121 stealthed Y shadowstrike Fluffy_Pillow 95.0/100: 95% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, goremaws_bite, finality_eviscerate(5)
3:33.127 finish L nightblade Fluffy_Pillow 77.0/100: 77% energy | 5.0/6: 83% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, goremaws_bite, finality_eviscerate(5)
3:34.129 stealthed Y shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, goremaws_bite, finality_eviscerate(5), finality_nightblade(5)
3:35.134 stealthed Y shadowstrike Fluffy_Pillow 82.0/100: 82% energy | 3.0/6: 50% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(5), finality_nightblade(5)
3:36.139 finish M eviscerate Fluffy_Pillow 59.0/100: 59% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(5), finality_nightblade(5)
3:37.144 build G backstab Fluffy_Pillow 75.0/100: 75% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_nightblade(5)
3:38.146 build G backstab Fluffy_Pillow 51.0/100: 51% energy | 2.0/6: 33% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_nightblade(5)
3:39.149 Waiting     0.800 sec 27.0/100: 27% energy | 4.0/6: 67% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_nightblade(5)
3:39.949 finish M eviscerate Fluffy_Pillow 35.8/100: 36% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_nightblade(5)
3:40.954 stealth_cds V shadow_dance Fluffy_Pillow 51.8/100: 52% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(5), finality_nightblade(5)
3:40.954 stealthed Y shadowstrike Fluffy_Pillow 76.8/100: 77% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(5), finality_nightblade(5)
3:41.960 stealthed Y shadowstrike Fluffy_Pillow 53.8/100: 54% energy | 3.0/6: 50% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(5), finality_nightblade(5)
3:42.964 Waiting     0.400 sec 30.8/100: 31% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(5), finality_nightblade(5)
3:43.364 finish M eviscerate Fluffy_Pillow 35.2/100: 35% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(5), finality_nightblade(5)
3:44.370 stealthed Y shadowstrike Fluffy_Pillow 51.2/100: 51% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(5)
3:45.376 Waiting     2.100 sec 28.2/100: 28% energy | 3.0/6: 50% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(5)
3:47.476 build G backstab Fluffy_Pillow 51.2/100: 51% energy | 3.0/6: 50% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_nightblade(5)
3:48.482 finish L nightblade Fluffy_Pillow 27.2/100: 27% energy | 6.0/6: 100% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_nightblade(5)
3:49.486 build G backstab Fluffy_Pillow 53.2/100: 53% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, shadow_blades
3:50.492 Waiting     2.000 sec 29.3/100: 29% energy | 2.0/6: 33% combo_points master_of_subtlety, symbols_of_death
3:52.492 build G backstab Fluffy_Pillow 51.2/100: 51% energy | 4.0/6: 67% combo_points symbols_of_death
3:53.496 Waiting     0.800 sec 27.2/100: 27% energy | 5.0/6: 83% combo_points symbols_of_death
3:54.296 finish M eviscerate Fluffy_Pillow 35.9/100: 36% energy | 5.0/6: 83% combo_points symbols_of_death
3:55.298 stealth_cds V shadow_dance Fluffy_Pillow 51.9/100: 52% energy | 0.0/6: 0% combo_points symbols_of_death, finality_eviscerate(5)
3:55.298 stealthed Y shadowstrike Fluffy_Pillow 76.9/100: 77% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5)
3:56.303 stealthed Y shadowstrike Fluffy_Pillow 53.9/100: 54% energy | 3.0/6: 50% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5)
3:57.306 Waiting     0.400 sec 30.9/100: 31% energy | 5.0/6: 83% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5)
3:57.706 finish M eviscerate Fluffy_Pillow 35.3/100: 35% energy | 5.0/6: 83% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5)
3:58.710 stealthed Y shadowstrike Fluffy_Pillow 51.3/100: 51% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
3:59.715 Waiting     2.100 sec 28.3/100: 28% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
4:01.815 build G backstab Fluffy_Pillow 51.3/100: 51% energy | 3.0/6: 50% combo_points master_of_subtlety, symbols_of_death
4:02.818 Waiting     2.200 sec 27.3/100: 27% energy | 4.0/6: 67% combo_points master_of_subtlety, symbols_of_death
4:05.018 build G backstab Fluffy_Pillow 51.4/100: 51% energy | 4.0/6: 67% combo_points master_of_subtlety, symbols_of_death
4:06.023 Waiting     0.300 sec 27.4/100: 27% energy | 6.0/6: 100% combo_points symbols_of_death
4:06.323 finish L nightblade Fluffy_Pillow 30.7/100: 31% energy | 6.0/6: 100% combo_points symbols_of_death
4:07.328 stealth_cds V shadow_dance Fluffy_Pillow 56.7/100: 57% energy | 0.0/6: 0% combo_points symbols_of_death, finality_nightblade(6)
4:07.328 stealthed W symbols_of_death Fluffy_Pillow 81.7/100: 82% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(6)
4:07.328 stealthed Y shadowstrike Fluffy_Pillow 46.7/100: 47% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, death, finality_nightblade(6)
4:08.334 stealthed Y shadowstrike Fluffy_Pillow 48.7/100: 49% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(6)
4:09.338 stealthed Y shadowstrike Fluffy_Pillow 50.7/100: 51% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(6)
4:10.342 finish M eviscerate Fluffy_Pillow 52.7/100: 53% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(6)
4:11.347 stealthed Y shadowstrike Fluffy_Pillow 68.7/100: 69% energy | 1.0/6: 17% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6), finality_nightblade(6)
4:12.351 Waiting     0.500 sec 45.7/100: 46% energy | 3.0/6: 50% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(6), finality_nightblade(6)
4:12.851 stealth_cds S vanish Fluffy_Pillow 51.2/100: 51% energy | 3.0/6: 50% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(6), finality_nightblade(6)
4:12.851 stealthed Y shadowstrike Fluffy_Pillow 76.2/100: 76% energy | 3.0/6: 50% combo_points master_of_subtlety_aura, vanish, symbols_of_death, finality_eviscerate(6), finality_nightblade(6)
4:13.855 finish M eviscerate Fluffy_Pillow 53.2/100: 53% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, vanish, subterfuge, symbols_of_death, finality_eviscerate(6), finality_nightblade(6)
4:14.860 stealthed Y shadowstrike Fluffy_Pillow 69.2/100: 69% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, vanish, subterfuge, symbols_of_death, finality_nightblade(6)
4:15.865 build G backstab Fluffy_Pillow 71.2/100: 71% energy | 2.0/6: 33% combo_points master_of_subtlety, symbols_of_death, finality_nightblade(6)
4:16.868 Waiting     0.400 sec 47.2/100: 47% energy | 3.0/6: 50% combo_points master_of_subtlety, symbols_of_death, finality_nightblade(6)
4:17.268 build G backstab Fluffy_Pillow 51.6/100: 52% energy | 3.0/6: 50% combo_points master_of_subtlety, symbols_of_death, finality_nightblade(6)
4:18.271 Waiting     0.700 sec 27.6/100: 28% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death, finality_nightblade(6)
4:18.971 finish M eviscerate Fluffy_Pillow 35.2/100: 35% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death, finality_nightblade(6)
4:19.975 stealth_cds V shadow_dance Fluffy_Pillow 51.2/100: 51% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5), finality_nightblade(6)
4:19.975 stealthed Y shadowstrike Fluffy_Pillow 76.2/100: 76% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5), finality_nightblade(6)
4:20.979 stealthed Y shadowstrike Fluffy_Pillow 53.2/100: 53% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5), finality_nightblade(6)
4:21.984 finish L nightblade Fluffy_Pillow 30.2/100: 30% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5), finality_nightblade(6)
4:22.986 stealthed Y shadowstrike Fluffy_Pillow 96.2/100: 96% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5)
4:23.990 stealthed Y shadowstrike Fluffy_Pillow 73.2/100: 73% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5)
4:24.994 build G backstab Fluffy_Pillow 75.2/100: 75% energy | 4.0/6: 67% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5)
4:25.998 finish M eviscerate Fluffy_Pillow 51.2/100: 51% energy | 6.0/6: 100% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5)
4:27.001 build G backstab Fluffy_Pillow 67.2/100: 67% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death
4:28.006 Waiting     0.800 sec 43.2/100: 43% energy | 1.0/6: 17% combo_points master_of_subtlety, symbols_of_death
4:28.806 build G backstab Fluffy_Pillow 52.0/100: 52% energy | 1.0/6: 17% combo_points master_of_subtlety, symbols_of_death
4:29.810 cds K goremaws_bite Fluffy_Pillow 28.0/100: 28% energy | 2.0/6: 33% combo_points master_of_subtlety, symbols_of_death
4:30.815 finish M eviscerate Fluffy_Pillow 44.0/100: 44% energy | 5.0/6: 83% combo_points symbols_of_death, goremaws_bite
4:31.819 stealth_cds V shadow_dance Fluffy_Pillow 65.0/100: 65% energy | 1.0/6: 17% combo_points symbols_of_death, goremaws_bite, finality_eviscerate(5)
4:31.819 stealthed Y shadowstrike Fluffy_Pillow 90.0/100: 90% energy | 1.0/6: 17% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, goremaws_bite, finality_eviscerate(5)
4:32.824 stealthed Y shadowstrike Fluffy_Pillow 72.0/100: 72% energy | 3.0/6: 50% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, goremaws_bite, finality_eviscerate(5)
4:33.828 finish M eviscerate Fluffy_Pillow 54.0/100: 54% energy | 5.0/6: 83% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, goremaws_bite, finality_eviscerate(5)
4:34.832 stealthed W symbols_of_death Fluffy_Pillow 75.0/100: 75% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, goremaws_bite
4:34.832 Waiting     0.100 sec 40.0/100: 40% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, goremaws_bite, death
4:34.932 stealthed Y shadowstrike Fluffy_Pillow 41.1/100: 41% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, goremaws_bite, death
4:35.936 Waiting     0.974 sec 23.1/100: 23% energy | 3.0/6: 50% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
4:36.910 stealth_cds T sprint Fluffy_Pillow 33.8/100: 34% energy | 3.0/6: 50% combo_points master_of_subtlety, symbols_of_death
4:36.910 Waiting     1.600 sec 33.8/100: 34% energy | 3.0/6: 50% combo_points master_of_subtlety, sprint, symbols_of_death, faster_than_light_trigger
4:38.510 build G backstab Fluffy_Pillow 51.3/100: 51% energy | 3.0/6: 50% combo_points master_of_subtlety, sprint, symbols_of_death, faster_than_light_trigger
4:39.514 Waiting     0.400 sec 27.3/100: 27% energy | 4.0/6: 67% combo_points master_of_subtlety, sprint, symbols_of_death, faster_than_light_trigger
4:39.914 stealthed Y shadowstrike Fluffy_Pillow 56.7/100: 57% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, vanish, subterfuge, sprint, symbols_of_death
4:40.919 finish M eviscerate Fluffy_Pillow 58.7/100: 59% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, vanish, subterfuge, sprint, symbols_of_death
4:41.925 stealthed Y shadowstrike Fluffy_Pillow 74.7/100: 75% energy | 1.0/6: 17% combo_points master_of_subtlety_aura, vanish, subterfuge, sprint, symbols_of_death, finality_eviscerate(6)
4:42.930 build G backstab Fluffy_Pillow 100.0/100: 100% energy | 3.0/6: 50% combo_points master_of_subtlety, sprint, symbols_of_death, finality_eviscerate(6)
4:43.936 build G backstab Fluffy_Pillow 76.0/100: 76% energy | 4.0/6: 67% combo_points master_of_subtlety, sprint, symbols_of_death, finality_eviscerate(6)
4:44.940 finish M eviscerate Fluffy_Pillow 52.0/100: 52% energy | 6.0/6: 100% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(6)
4:45.944 stealth_cds V shadow_dance Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death
4:45.944 stealthed W symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
4:45.944 stealthed Y shadowstrike Fluffy_Pillow 65.0/100: 65% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, death
4:46.950 stealthed Y shadowstrike Fluffy_Pillow 42.0/100: 42% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
4:47.955 Waiting     1.844 sec 19.0/100: 19% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
4:49.799 finish M eviscerate Fluffy_Pillow 39.2/100: 39% energy | 5.0/6: 83% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
4:50.804 stealthed Y shadowstrike Fluffy_Pillow 55.2/100: 55% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5)
4:51.808 build G backstab Fluffy_Pillow 57.2/100: 57% energy | 2.0/6: 33% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5)
4:52.812 Waiting     0.700 sec 33.2/100: 33% energy | 3.0/6: 50% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 8806 8481 0
Agility 28239 26533 16240 (10748)
Stamina 48391 48391 28183
Intellect 5325 5000 0
Spirit 0 0 0
Health 2903460 2903460 0
Energy 100 100 0
Combo Points 6 6 0
Crit 23.64% 23.64% 5456
Haste 9.55% 9.55% 3581
Damage / Heal Versatility 9.03% 8.23% 3909
Attack Power 28239 26533 0
Mastery 80.81% 80.81% 8510
Armor 2297 2297 2297
Run Speed 8 0 0

Gear

Source Slot Average Item Level: 888.00
Local Head Cowl of Fright
ilevel: 885, stats: { 300 Armor, +2829 Sta, +1886 AgiInt, +1015 Mastery, +547 Crit, +1076 unknown }
Local Neck Sea Fan Pendant
ilevel: 880, stats: { +1519 Sta, +1633 Vers, +965 Mastery }, enchant: mark_of_the_hidden_satyr
Local Shoulders Steelgazer Hide Mantle
ilevel: 880, stats: { 273 Armor, +1351 AgiInt, +2027 Sta, +673 Haste, +476 Vers, +771 unknown }
Local Shirt Common Gray Shirt
ilevel: 1
Local Chest Biornskin Vest
ilevel: 890, stats: { 376 Armor, +1977 AgiInt, +2965 Sta, +1034 Crit, +557 Mastery }
Local Waist Strand of Whelk Shells
ilevel: 880, stats: { 205 Armor, +2026 Sta, +1351 AgiInt, +673 Haste, +476 Mastery }, gems: { +150 Mastery }
Local Legs Legwraps of Unworthy Souls
ilevel: 880, stats: { 318 Armor, +2701 Sta, +1801 AgiInt, +964 Mastery, +570 Haste }
Local Feet Shadow Satyr's Walk
ilevel: 910, stats: { 276 Armor, +2680 Sta, +1786 Agi, +827 Haste, +459 Mastery }
Local Wrists Denial of the Half-Giants
ilevel: 910, stats: { 176 Armor, +2010 Sta, +1340 Agi, +276 Crit, +689 Mastery }
Local Hands Cruel Vice Grips
ilevel: 885, stats: { 231 Armor, +2122 Sta, +1415 AgiInt, +686 Crit, +485 Mastery }
Local Finger1 Grubby Silver Ring
ilevel: 880, stats: { +1519 Sta, +1484 Crit, +1114 Vers }, gems: { +150 Vers }, enchant: { +200 Mastery }
Local Finger2 Ring of Collapsing Futures
ilevel: 870, stats: { +1385 Sta, +1677 Mastery, +768 Haste, +419 Avoidance }, enchant: { +200 Vers }
Local Back Drape of the Mana-Starved
ilevel: 875, stats: { 142 Armor, +1450 Sta, +967 StrAgiInt, +586 Crit, +259 Vers }, gems: { +200 Agi }, enchant: { +200 Agi }
Local Main Hand Fangs of the Devourer
ilevel: 906, weapon: { 3844 - 7140, 1.8 }, stats: { +983 Agi, +1475 Sta, +368 Crit, +353 Mastery }, relics: { +53 ilevels, +51 ilevels, +52 ilevels }
Local Off Hand Fangs of the Devourer
ilevel: 906, weapon: { 3844 - 7140, 1.8 }, stats: { +983 Agi, +1475 Sta, +368 Crit, +353 Mastery }

Talents

Level
15 Master of Subtlety (Subtlety Rogue) Weaponmaster (Subtlety Rogue) Gloomblade (Subtlety Rogue)
30 Nightstalker Subterfuge Shadow Focus
45 Deeper Stratagem Anticipation Vigor
60 Soothing Darkness (Subtlety Rogue) Elusiveness Cheat Death
75 Strike from the Shadows (Subtlety Rogue) Prey on the Weak Tangled Shadow (Subtlety Rogue)
90 Premeditation (Subtlety Rogue) Alacrity Enveloping Shadows (Subtlety Rogue)
100 Master of Shadows (Subtlety Rogue) Marked for Death Death from Above

Profile

rogue="EsdeathSAMA"
origin="https://eu.api.battle.net/wow/character/dalaran/Esdeåth/advanced"
thumbnail="http://eu.battle.net/static-render/eu/dalaran/53/127409205-avatar.jpg"
level=110
race=human
role=attack
position=back
professions=alchemy=800/enchanting=133
talents=1210011
artifact=17:0:0:0:0:851:1:852:3:853:3:854:3:855:3:856:3:857:3:858:3:859:3:860:3:861:1:862:1:863:1:864:1:865:1:866:1:1349:1:1386:14
spec=subtlety

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,name=flask_of_the_seventh_demon
actions.precombat+=/augmentation,name=defiled
actions.precombat+=/food,name=seedbattered_fish_plate
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/stealth
actions.precombat+=/potion,name=old_war
actions.precombat+=/marked_for_death,if=raid_event.adds.in>40
# Defined variables that doesn't change during the fight
actions.precombat+=/variable,name=ssw_refund,value=equipped.shadow_satyrs_walk*(4+ssw_refund_offset)
actions.precombat+=/variable,name=stealth_threshold,value=(15+talent.vigor.enabled*35+talent.master_of_shadows.enabled*30+variable.ssw_refund)
actions.precombat+=/enveloping_shadows,if=combo_points>=5
actions.precombat+=/symbols_of_death

# Executed every time the actor is available.
actions=call_action_list,name=cds
# Fully switch to the Stealthed Rotation (by doing so, it forces pooling if nothing is available)
actions+=/run_action_list,name=stealthed,if=stealthed.all
actions+=/call_action_list,name=finish,if=combo_points>=5|(combo_points>=4&spell_targets.shuriken_storm>=3&spell_targets.shuriken_storm<=4)
actions+=/call_action_list,name=stealth_als,if=combo_points.deficit>=2+talent.premeditation.enabled
actions+=/call_action_list,name=build,if=energy.deficit<=variable.stealth_threshold

# Builders
actions.build=shuriken_storm,if=spell_targets.shuriken_storm>=2
actions.build+=/gloomblade
actions.build+=/backstab

# Cooldowns
actions.cds=potion,name=old_war,if=buff.bloodlust.react|target.time_to_die<=25|buff.shadow_blades.up
actions.cds+=/use_item,slot=finger2,if=(buff.shadow_blades.up&stealthed.rogue)|target.time_to_die<20
actions.cds+=/blood_fury,if=stealthed.rogue
actions.cds+=/berserking,if=stealthed.rogue
actions.cds+=/arcane_torrent,if=stealthed.rogue&energy.deficit>70
actions.cds+=/shadow_blades,if=combo_points<=2|(equipped.denial_of_the_halfgiants&combo_points>=1)
actions.cds+=/goremaws_bite,if=!stealthed.all&cooldown.shadow_dance.charges_fractional<=2.45&((combo_points.deficit>=4-(time<10)*2&energy.deficit>50+talent.vigor.enabled*25-(time>=10)*15)|target.time_to_die<8)
actions.cds+=/marked_for_death,target_if=min:target.time_to_die,if=target.time_to_die<combo_points.deficit|(raid_event.adds.in>40&combo_points.deficit>=4+talent.deeper_strategem.enabled+talent.anticipation.enabled)

# Finishers
actions.finish=enveloping_shadows,if=buff.enveloping_shadows.remains<target.time_to_die&buff.enveloping_shadows.remains<=combo_points*1.8
actions.finish+=/death_from_above,if=spell_targets.death_from_above>=6
actions.finish+=/nightblade,cycle_targets=1,if=target.time_to_die>8&((refreshable&(!finality|buff.finality_nightblade.up))|remains<tick_time)
actions.finish+=/death_from_above
actions.finish+=/eviscerate

# Stealth Action List Starter
actions.stealth_als=call_action_list,name=stealth_cds,if=energy.deficit<=variable.stealth_threshold&(!equipped.shadow_satyrs_walk|cooldown.shadow_dance.charges_fractional>=2.45|energy.deficit>=10)
actions.stealth_als+=/call_action_list,name=stealth_cds,if=spell_targets.shuriken_storm>=5
actions.stealth_als+=/call_action_list,name=stealth_cds,if=(cooldown.shadowmeld.up&!cooldown.vanish.up&cooldown.shadow_dance.charges<=1)
actions.stealth_als+=/call_action_list,name=stealth_cds,if=target.time_to_die<12*cooldown.shadow_dance.charges_fractional*(1+equipped.shadow_satyrs_walk*0.5)

# Stealth Cooldowns
actions.stealth_cds=shadow_dance,if=charges_fractional>=2.45
actions.stealth_cds+=/vanish
actions.stealth_cds+=/sprint_offensive
actions.stealth_cds+=/shadow_dance,if=charges>=2&combo_points<=1
actions.stealth_cds+=/pool_resource,for_next=1,extra_amount=40
actions.stealth_cds+=/shadowmeld,if=energy>=40&energy.deficit>=10+variable.ssw_refund
actions.stealth_cds+=/shadow_dance,if=combo_points<=1

# Stealthed Rotation
actions.stealthed=symbols_of_death,if=(buff.symbols_of_death.remains<target.time_to_die-4&buff.symbols_of_death.remains<=buff.symbols_of_death.duration*0.3)|equipped.shadow_satyrs_walk&energy.time_to_max<0.25
actions.stealthed+=/call_action_list,name=finish,if=combo_points>=5
actions.stealthed+=/shuriken_storm,if=buff.shadowmeld.down&((combo_points.deficit>=3&spell_targets.shuriken_storm>=2+talent.premeditation.enabled+equipped.shadow_satyrs_walk)|buff.the_dreadlords_deceit.stack>=29)
actions.stealthed+=/shadowstrike

head=cowl_of_fright,id=139205,bonus_id=1805/43/1507/3337
neck=sea_fan_pendant,id=142428,bonus_id=3507/1497,enchant=mark_of_the_hidden_satyr
shoulders=steelgazer_hide_mantle,id=134154,bonus_id=3417/43/1542/3337
back=drape_of_the_manastarved,id=141543,bonus_id=1808/1487/3337,gems=200agi,enchant=200agi
chest=biornskin_vest,id=134197,bonus_id=3417/1552/3337
shirt=common_gray_shirt,id=3428
wrists=denial_of_the_halfgiants,id=137100,bonus_id=3459/3458
hands=cruel_vice_grips,id=133617,bonus_id=3510/1537/3337
waist=strand_of_whelk_shells,id=142416,bonus_id=3507/1808/1497,gems=150mastery
legs=legwraps_of_unworthy_souls,id=133616,bonus_id=3418/1532/3337
feet=shadow_satyrs_walk,id=137032,bonus_id=3459/3458
finger1=grubby_silver_ring,id=139236,bonus_id=1806/1808/1502,gems=150vers,enchant=200mastery
finger2=ring_of_collapsing_futures,id=142173,bonus_id=40/3453/1482/3336,enchant=200vers
main_hand=fangs_of_the_devourer,id=128476,bonus_id=743,gem_id=139267/142512/139253/0,relic_id=1806:1507:3336/3468:1492/1806:1502/0
off_hand=fangs_of_the_devourer,id=128479

# Gear Summary
# gear_ilvl=888.36
# gear_agility=16240
# gear_stamina=28183
# gear_crit_rating=5349
# gear_haste_rating=3511
# gear_mastery_rating=8343
# gear_versatility_rating=3832
# gear_avoidance_rating=419
# gear_armor=2297

NF+DoS : 583301 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
583300.8 583300.8 733.0 / 0.126% 101954.5 / 17.5% 20344.8
RPS Out RPS In Primary Resource Waiting APM Active Skill
28.6 28.6 Energy 21.10% 56.6 100.0% 100%
Origin https://eu.api.battle.net/wow/character/dalaran/Esdeåth/advanced
Talents
  • 15: Master of Subtlety (Subtlety Rogue)
  • 30: Subterfuge
  • 45: Deeper Stratagem
  • 90: Premeditation (Subtlety Rogue)
  • 100: Master of Shadows (Subtlety Rogue)
  • Talent Calculator
Artifact
Professions
  • alchemy: 800
  • enchanting: 133

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
NF+DoS 583301
auto_attack_mh 10295 1.8% 126.3 1.96sec 24753 16010 Direct 126.3 23644 47291 24752 23.7% 19.0%  

Stats details: auto_attack_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 126.35 126.35 0.00 0.00 1.5460 0.0000 3127486.56 4597701.49 31.98 16010.31 16010.31
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 72.50 57.38% 23643.87 18265 24110 23649.10 23153 24024 1714178 2520004 31.98
crit 29.89 23.65% 47290.58 36530 48220 47300.08 45517 48220 1413308 2077697 31.98
miss 23.96 18.97% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_mh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
auto_attack_oh 5107 0.9% 125.5 1.97sec 12365 7941 Direct 125.5 11818 23641 12365 23.6% 19.0%  

Stats details: auto_attack_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 125.49 125.49 0.00 0.00 1.5572 0.0000 1551628.88 2281041.43 31.98 7940.54 7940.54
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 71.97 57.35% 11818.43 9133 12055 11821.33 11493 12017 850559 1250402 31.98
crit 29.66 23.63% 23640.81 18265 24110 23646.25 22871 24110 701070 1030640 31.98
miss 23.86 19.02% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_oh

Static Values
  • id:1
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Backstab 28098 4.8% 52.9 5.40sec 160618 159900 Direct 52.9 129985 259936 160619 23.6% 0.0%  

Stats details: backstab

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 52.87 52.87 0.00 0.00 1.0045 0.0000 8492473.82 12484740.94 31.98 159900.47 159900.47
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 40.41 76.43% 129984.66 101005 133327 130018.20 125998 132923 5252612 7721838 31.98
crit 12.46 23.57% 259935.83 202010 266653 260022.83 235948 266653 3239862 4762903 31.98
 
 

Action details: backstab

Static Values
  • id:53
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:53
  • name:Backstab
  • school:physical
  • tooltip:
  • description:Stab the target, causing ${$sw2*$<mult>} Physical damage. Damage increased by {$s4=30}% when you are behind your target. |cFFFFFFFFAwards {$s3=1} combo $lpoint:points;.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.70
 
Collapse 1639 0.3% 5.9 43.38sec 82317 0 Direct 5.9 66457 132943 82323 23.9% 0.0%  

Stats details: collapse

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.91 5.91 0.00 0.00 0.0000 0.0000 486723.76 486723.76 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.50 76.15% 66456.93 50574 66758 66139.99 0 66758 299211 299211 0.00
crit 1.41 23.85% 132942.77 101148 133516 100218.13 0 133516 187512 187512 0.00
 
 

Action details: collapse

Static Values
  • id:234142
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:15.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:234142
  • name:Collapse
  • school:shadow
  • tooltip:
  • description:Deal {$s1=40000} Shadow damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:40000.00
  • base_dd_max:40000.00
 
Eviscerate 155918 26.7% 52.4 5.66sec 893293 889292 Direct 52.4 643635 1287995 893301 38.7% 0.0%  

Stats details: eviscerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 52.35 52.35 0.00 0.00 1.0045 0.0000 46764296.24 68747945.11 31.98 889291.76 889291.76
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 32.07 61.25% 643634.61 401033 787693 644005.91 586663 703664 20639315 30341748 31.98
crit 20.28 38.75% 1287995.14 802066 1575386 1288695.66 1158275 1440639 26124981 38406197 31.98
 
 

Action details: eviscerate

Static Values
  • id:196819
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.15
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:196819
  • name:Eviscerate
  • school:physical
  • tooltip:
  • description:Finishing move that disembowels the target, causing damage per combo point. 1 point : ${$m1*1} damage 2 points: ${$m1*2} damage 3 points: ${$m1*3} damage 4 points: ${$m1*4} damage 5 points: ${$m1*5} damage{$?s193531=false}[ 6 points: ${$m1*6} damage][]
Weapon
  • normalized:false
  • weapon_power_mod:0.000000
  • weapon_multiplier:0.00
 
Fel-Crazed Rage 36394 6.2% 35.8 8.11sec 305093 0 Direct 35.8 246936 493873 305158 23.6% 0.0%  

Stats details: felcrazed_rage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 35.84 35.84 0.00 0.00 0.0000 0.0000 10935426.83 10935426.83 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 27.39 76.43% 246936.41 188967 249436 247096.79 218931 249436 6763087 6763087 0.00
crit 8.45 23.57% 493872.83 377933 498872 494010.92 0 498872 4172340 4172340 0.00
 
 

Action details: felcrazed_rage

Static Values
  • id:225777
  • school:shadow
  • resource:none
  • range:8.0
  • travel_speed:30.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:225777
  • name:Fel-Crazed Rage
  • school:shadow
  • tooltip:
  • description:{$@spelldesc225141=Enter a fel-crazed rage, dealing {$225777s1=53264 to 58870} Shadow damage to a random nearby enemy every ${$t1}.2 sec for {$d=3 seconds}. You cannot move or use abilities during your rage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:141984.15
  • base_dd_max:156929.85
 
Goremaw's Bite 0 (9430) 0.0% (1.6%) 4.6 63.51sec 611167 608513

Stats details: goremaws_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.65 0.00 0.00 0.00 1.0045 0.0000 0.00 0.00 0.00 608512.92 608512.92
 
 

Action details: goremaws_bite

Static Values
  • id:209782
  • school:shadow
  • resource:none
  • range:8.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!stealthed.all&cooldown.shadow_dance.charges_fractional<=2.45&((combo_points.deficit>=4-(time<10)*2&energy.deficit>50+talent.vigor.enabled*25-(time>=10)*15)|target.time_to_die<8)
Spelldata
  • id:209782
  • name:Goremaw's Bite
  • school:physical
  • tooltip:
  • description:Lashes out at the target, inflicting ${$209783sw2+$209784sw2} Shadow damage and reducing movement speed by {$209786s1=60}% for {$209786d=8 seconds}. Grants $220901o2 Energy over {$220901d=6 seconds}. |cFFFFFFFFAwards {$220901s1=3} combo $lpoint:points;.|r
 
    Goremaw's Bite (_mh) 6282 1.1% 4.6 63.51sec 407102 0 Direct 4.6 329059 657981 407102 23.7% 0.0%  

Stats details: goremaws_bite_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.65 4.65 0.00 0.00 0.0000 0.0000 1892100.23 1892100.23 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 3.54 76.27% 329058.50 257468 339858 328397.79 0 339858 1166483 1166483 0.00
crit 1.10 23.73% 657980.59 514937 679717 467583.35 0 679717 725617 725617 0.00
 
 

Action details: goremaws_bite_mh

Static Values
  • id:209783
  • school:shadow
  • resource:none
  • range:8.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:209783
  • name:Goremaw's Bite
  • school:shadow
  • tooltip:
  • description:{$@spelldesc209782=Lashes out at the target, inflicting ${$209783sw2+$209784sw2} Shadow damage and reducing movement speed by {$209786s1=60}% for {$209786d=8 seconds}. Grants $220901o2 Energy over {$220901d=6 seconds}. |cFFFFFFFFAwards {$220901s1=3} combo $lpoint:points;.|r}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:10.00
 
    Goremaw's Bite (_oh) 3148 0.5% 4.6 63.51sec 204065 0 Direct 4.6 164548 328942 204070 24.0% 0.0%  

Stats details: goremaws_bite_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.65 4.65 0.00 0.00 0.0000 0.0000 948438.06 948438.06 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 3.53 75.96% 164547.67 128741 169938 164059.06 0 169938 580929 580929 0.00
crit 1.12 24.04% 328942.03 257481 339875 233190.26 0 339875 367509 367509 0.00
 
 

Action details: goremaws_bite_oh

Static Values
  • id:209784
  • school:shadow
  • resource:none
  • range:8.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:209784
  • name:Goremaw's Bite
  • school:shadow
  • tooltip:
  • description:{$@spelldesc209782=Lashes out at the target, inflicting ${$209783sw2+$209784sw2} Shadow damage and reducing movement speed by {$209786s1=60}% for {$209786d=8 seconds}. Grants $220901o2 Energy over {$220901d=6 seconds}. |cFFFFFFFFAwards {$220901s1=3} combo $lpoint:points;.|r}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:10.00
 
Mark of the Hidden Satyr 8311 1.4% 16.7 17.73sec 149622 0 Direct 16.7 121036 242025 149613 23.6% 0.0%  

Stats details: mark_of_the_hidden_satyr

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.72 16.72 0.00 0.00 0.0000 0.0000 2501694.07 2501694.07 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 12.77 76.37% 121035.78 93052 122828 121066.40 115384 122828 1545598 1545598 0.00
crit 3.95 23.63% 242025.06 186103 245656 237126.37 0 245656 956096 956096 0.00
 
 

Action details: mark_of_the_hidden_satyr

Static Values
  • id:191259
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191259
  • name:Mark of the Hidden Satyr
  • school:fire
  • tooltip:
  • description:Deals fire damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:2.500000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Nightblade 109440 18.8% 16.9 17.47sec 1945882 1937237 Periodic 143.2 186208 372506 230242 23.6% 0.0% 95.1%

Stats details: nightblade

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.94 0.00 143.21 143.21 1.0045 2.0000 32971782.04 32971782.04 0.00 108663.20 1937237.49
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 109.4 76.36% 186207.92 127142 208112 186240.89 180625 191364 20363295 20363295 0.00
crit 33.8 23.64% 372506.17 254285 416223 372580.59 347684 400884 12608487 12608487 0.00
 
 

Action details: nightblade

Static Values
  • id:195452
  • school:shadow
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:25.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:target.time_to_die>8&((refreshable&(!finality|buff.finality_nightblade.up))|remains<tick_time)
Spelldata
  • id:195452
  • name:Nightblade
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec and snared by attacks.
  • description:Finishing move that infects the target with shadowy energy, dealing Shadow damage over time and causing attacks against the target to reduce movement speed by {$206760s1=30}% for {$206760d=8 seconds}. Lasts longer per combo point. 1 point : ${$m1*8/2} over 8 sec 2 points: ${$m1*10/2} over 10 sec 3 points: ${$m1*12/2} over 12 sec 4 points: ${$m1*14/2} over 14 sec 5 points: ${$m1*16/2} over 16 sec{$?s193531=false}[ 6 points: ${$m1*18/2} over 18 sec][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:1.380000
  • spell_power_mod.tick:0.000000
  • base_td:1.00
  • dot_duration:6.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Potion of the Old War 17664 3.0% 22.1 9.51sec 236299 0 Direct 22.1 190895 381755 236295 23.8% 0.0%  

Stats details: potion_of_the_old_war

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.09 22.09 0.00 0.00 0.0000 0.0000 5219905.58 7673755.65 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.84 76.21% 190895.36 146122 192882 190893.90 179961 192882 3213811 4724607 31.98
crit 5.25 23.79% 381754.77 292245 385763 380986.92 0 385763 2006094 2949149 31.91
 
 

Action details: potion_of_the_old_war

Static Values
  • id:188028
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188028
  • name:Potion of the Old War
  • school:physical
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:135920.00
  • base_dd_max:203880.00
 
Recursive Strikes 40302 6.9% 81.4 4.70sec 148697 0 Direct 81.4 120215 240797 148694 23.6% 0.0%  

Stats details: recursive_strikes

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 81.37 81.37 0.00 0.00 0.0000 0.0000 12099180.86 17786941.92 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 62.15 76.38% 120215.04 24772 174395 119065.87 66955 151711 7471799 10984253 31.98
crit 19.22 23.62% 240797.41 49544 348790 238115.35 0 348790 4627382 6802689 31.97
 
 

Action details: recursive_strikes

Static Values
  • id:225739
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:225739
  • name:Recursive Strikes
  • school:physical
  • tooltip:
  • description:{$@spelldesc225135=Your attacks have a chance to grant Recursive Strikes for {$225736d=15 seconds}, causing your auto attacks to deal an additional {$225736s1=3602} damage and increase the intensity of Recursive Strikes.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:9601.48
  • base_dd_max:9601.48
 
Shadow Blades 0 (14018) 0.0% (2.4%) 2.1 180.24sec 1978811 0

Stats details: shadow_blades

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.10 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: shadow_blades

Static Values
  • id:121471
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:combo_points<=2|(equipped.denial_of_the_halfgiants&combo_points>=1)
Spelldata
  • id:121471
  • name:Shadow Blades
  • school:physical
  • tooltip:Autoattacks deal pure Shadow damage. Combo-point-generating attacks generate {$s2=1} additional combo point.
  • description:Draws upon surrounding shadows to empower your weapons, causing auto attacks to deal Shadow damage and abilities that generate combo points to generate 1 additional combo point. Lasts {$d=15 seconds}.
 
    Shadow Blade (_mh) 9346 1.6% 63.7 3.70sec 43436 31079 Direct 63.7 35159 70306 43437 23.5% 0.0%  

Stats details: shadow_blade_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 63.65 63.65 0.00 0.00 1.3976 0.0000 2764892.72 2764892.72 0.00 31079.13 31079.13
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 48.66 76.45% 35158.88 26852 35444 35157.00 34244 35444 1710984 1710984 0.00
crit 14.99 23.55% 70306.17 53703 70888 70302.33 67373 70888 1053909 1053909 0.00
 
 

Action details: shadow_blade_mh

Static Values
  • id:121473
  • school:shadow
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:121473
  • name:Shadow Blade
  • school:shadow
  • tooltip:
  • description:Strike with dark energy, dealing Shadow damage equal to {$s1=1}% weapon damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
    Shadow Blade Off-hand 4673 0.8% 63.7 3.70sec 21723 15543 Direct 63.7 17579 35154 21723 23.6% 0.0%  

Stats details: shadow_blade_offhand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 63.65 63.65 0.00 0.00 1.3976 0.0000 1382733.41 1382733.41 0.00 15542.79 15542.79
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 48.65 76.42% 17579.35 13426 17722 17578.55 17041 17722 855198 855198 0.00
crit 15.01 23.58% 35153.67 26852 35444 35151.41 33488 35444 527536 527536 0.00
 
 

Action details: shadow_blade_offhand

Static Values
  • id:121474
  • school:shadow
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:121474
  • name:Shadow Blade Off-hand
  • school:shadow
  • tooltip:
  • description:Strike with dark energy, dealing Shadow damage equal to {$s1=1}% weapon damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Shadow Nova 9956 1.7% 31.6 9.54sec 94761 0 Direct 31.6 76640 153279 94760 23.6% 0.0%  

Stats details: shadow_nova

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 31.56 31.56 0.00 0.00 0.0000 0.0000 2990950.15 2990950.15 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 24.10 76.36% 76639.69 63871 76645 76639.89 75935 76645 1847018 1847018 0.00
crit 7.46 23.64% 153278.59 127741 153290 153279.04 144773 153290 1143932 1143932 0.00
 
 

Action details: shadow_nova

Static Values
  • id:197800
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:5.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:197800
  • name:Shadow Nova
  • school:shadow
  • tooltip:
  • description:Deals {$s1=0} Shadow damage to enemies with $A1 yards.
 
Shadowstrike 111453 (136728) 19.1% (23.4%) 101.6 2.92sec 403999 402188 Direct 101.6 246291 492592 329300 33.7% 0.0%  

Stats details: shadowstrike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 101.58 101.58 0.00 0.00 1.0045 0.0000 33450130.38 49174860.14 31.98 402188.07 402188.07
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 67.35 66.30% 246290.55 205255 246306 246291.19 244382 246306 16586503 24383730 31.98
crit 34.23 33.70% 492592.39 410510 492612 492593.05 487315 492612 16863628 24791130 31.98
 
 

Action details: shadowstrike

Static Values
  • id:185438
  • school:physical
  • resource:energy
  • range:15.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:185438
  • name:Shadowstrike
  • school:physical
  • tooltip:
  • description:Strike through the shadows, $?a231718[appearing behind your target and ][]dealing $sw2 Physical damage. |cFFFFFFFFAwards {$s3=1} combo $lpoint:points;.|r
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:8.50
 
    Soul Rip 25276 4.3% 101.0 2.92sec 75135 0 Direct 101.0 60831 121661 75134 23.5% 0.0%  

Stats details: soul_rip

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 100.99 100.99 0.00 0.00 0.0000 0.0000 7587933.59 7587933.59 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 77.24 76.48% 60830.51 60831 60831 60830.51 60831 60831 4698612 4698612 0.00
crit 23.75 23.52% 121661.02 121661 121661 121661.02 121661 121661 2889321 2889321 0.00
 
 

Action details: soul_rip

Static Values
  • id:220893
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:220893
  • name:Soul Rip
  • school:shadow
  • tooltip:
  • description:{$@spelldesc209835=After using Shadowstrike or Cheap Shot, Akaari's Soul appears $m1 sec later and Soul Rips your target, dealing {$220893s1=1} Shadow damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:1.500000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Simple Action Stats Execute Interval
NF+DoS
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:NF+DoS
  • harmful:false
  • if_expr:
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:NF+DoS
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:NF+DoS
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Shadow Dance 25.8 11.58sec

Stats details: shadow_dance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 25.83 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: shadow_dance

Static Values
  • id:185313
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:charges_fractional>=2.45
Spelldata
  • id:185313
  • name:Shadow Dance
  • school:physical
  • tooltip:
  • description:Allows use of all Stealth abilities and grants all the combat benefits of Stealth for {$d=3 seconds}. Effect not broken from taking damage or attacking. {$?s14062=false}[Movement speed while active is increased by {$1784s3=0}% and damage dealt is increased by {$1784s4=0}%. ]?s108209[Abilities cost {$112942s1=75}% less while active. ][]{$?s31223=false}[Attacks from Shadow Dance and for {$31223s1=5} sec after deal {$31665s1=10}% more damage. ][]
 
Sprint 2.7 122.28sec

Stats details: sprint

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.71 0.00 85.77 0.00 0.0000 0.2500 0.00 0.00 0.00 0.00 0.00
 
 

Action details: sprint

Static Values
  • id:2983
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:2983
  • name:Sprint
  • school:physical
  • tooltip:Movement speed increased by $w1%.
  • description:Increases your movement speed by {$s1=70}% for {$d=8 seconds}. Usable while stealthed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:0.25
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Symbols of Death 13.6 23.43sec

Stats details: symbols_of_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.58 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: symbols_of_death

Static Values
  • id:212283
  • school:physical
  • resource:energy
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:10.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:212283
  • name:Symbols of Death
  • school:physical
  • tooltip:All damage done increased by {$s1=20}%.
  • description:Invoke ancient symbols of power, increasing all damage you deal by {$s1=20}% for {$d=35 seconds}, and causing your next Shadowstrike to critically strike. Unaffected by the global cooldown.
 
Vanish 2.8 122.25sec

Stats details: vanish

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.80 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: vanish

Static Values
  • id:1856
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:1856
  • name:Vanish
  • school:physical
  • tooltip:Improved stealth.
  • description:Allows you to vanish from sight, entering stealth while in combat. For the first {$11327d=3 seconds} after vanishing, damage and harmful effects received will not break stealth. Also breaks movement impairing effects.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 33.33% 0.0(0.0) 1.0

Buff details

  • buff initial source:NF+DoS
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Death 13.6 0.0 22.4sec 23.3sec 2.38% 13.20% 0.0(0.0) 0.2

Buff details

  • buff initial source:NF+DoS
  • cooldown name:buff_death
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • death_1:2.38%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:227151
  • name:Death
  • tooltip:Your next Shadowstrike will critically strike.
  • description:{$@spelldesc212283=Invoke ancient symbols of power, increasing all damage you deal by {$s1=20}% for {$d=35 seconds}, and causing your next Shadowstrike to critically strike. Unaffected by the global cooldown.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Faster Than Light Trigger 2.7 0.0 122.3sec 122.3sec 2.69% 2.69% 0.0(0.0) 2.7

Buff details

  • buff initial source:NF+DoS
  • cooldown name:buff_faster_than_light_trigger
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • faster_than_light_trigger_1:2.69%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:197270
  • name:Faster Than Light Trigger
  • tooltip:
  • description:
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
Finality: Eviscerate 26.4 0.0 11.3sec 11.3sec 48.34% 49.51% 0.0(0.0) 0.0

Buff details

  • buff initial source:NF+DoS
  • cooldown name:buff_finality_eviscerate
  • max_stacks:10
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.04

Stack Uptimes

  • finality_eviscerate_5:23.11%
  • finality_eviscerate_6:25.23%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:197496
  • name:Finality: Eviscerate
  • tooltip:Your next Eviscerate will do $w1% increased damage.
  • description:
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Finality: Nightblade 8.7 0.0 35.1sec 35.1sec 42.90% 40.91% 0.0(0.0) 0.0

Buff details

  • buff initial source:NF+DoS
  • cooldown name:buff_finality_nightblade
  • max_stacks:6
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.04

Stack Uptimes

  • finality_nightblade_5:17.53%
  • finality_nightblade_6:25.37%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:197498
  • name:Finality: Nightblade
  • tooltip:Your next Nightblade will do $w1% increased damage.
  • description:
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Goremaw's Bite 4.6 0.0 63.5sec 63.5sec 9.13% 9.13% 27.5(27.5) 4.5

Buff details

  • buff initial source:NF+DoS
  • cooldown name:buff_goremaws_bite
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • goremaws_bite_1:9.13%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:220901
  • name:Goremaw's Bite
  • tooltip:Generating {$s2=5} Energy every $t2 sec.
  • description:{$@spelldesc209782=Lashes out at the target, inflicting ${$209783sw2+$209784sw2} Shadow damage and reducing movement speed by {$209786s1=60}% for {$209786d=8 seconds}. Grants $220901o2 Energy over {$220901d=6 seconds}. |cFFFFFFFFAwards {$220901s1=3} combo $lpoint:points;.|r}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Master of Subtlety 36.4 1.4 8.3sec 7.9sec 34.41% 47.10% 1.4(1.4) 12.8

Buff details

  • buff initial source:NF+DoS
  • cooldown name:buff_master_of_subtlety
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • master_of_subtlety_1:34.41%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:31223
  • name:Master of Subtlety
  • tooltip:
  • description:Attacks made while stealthed and for {$s1=5} seconds after breaking stealth cause an additional {$31665s1=10}% damage.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Master of Subtlety (_aura) 36.4 1.4 8.3sec 8.1sec 48.71% 34.76% 1.4(1.4) 0.0

Buff details

  • buff initial source:NF+DoS
  • cooldown name:buff_master_of_subtlety_aura
  • max_stacks:1
  • duration:150.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • master_of_subtlety_aura_1:48.71%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:31223
  • name:Master of Subtlety
  • tooltip:
  • description:Attacks made while stealthed and for {$s1=5} seconds after breaking stealth cause an additional {$31665s1=10}% damage.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of the Old War 2.0 0.0 180.0sec 0.0sec 16.24% 16.24% 0.0(0.0) 2.0

Buff details

  • buff initial source:NF+DoS
  • cooldown name:buff_potion_of_the_old_war
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_the_old_war_1:16.24%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188028
  • name:Potion of the Old War
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Recursive Strikes 4.4 82.5 61.3sec 2.6sec 24.18% 100.00% 22.9(22.9) 4.2

Buff details

  • buff initial source:NF+DoS
  • cooldown name:buff_recursive_strikes
  • max_stacks:15
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • recursive_strikes_1:0.84%
  • recursive_strikes_2:1.16%
  • recursive_strikes_3:1.44%
  • recursive_strikes_4:1.19%
  • recursive_strikes_5:1.40%
  • recursive_strikes_6:1.21%
  • recursive_strikes_7:1.38%
  • recursive_strikes_8:1.21%
  • recursive_strikes_9:1.34%
  • recursive_strikes_10:1.22%
  • recursive_strikes_11:1.31%
  • recursive_strikes_12:1.20%
  • recursive_strikes_13:1.27%
  • recursive_strikes_14:1.10%
  • recursive_strikes_15:6.92%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225736
  • name:Recursive Strikes
  • tooltip:Your auto attacks deal an additional $w1 damage and increase the potency of this effect.
  • description:{$@spelldesc225135=Your attacks have a chance to grant Recursive Strikes for {$225736d=15 seconds}, causing your auto attacks to deal an additional {$225736s1=3602} damage and increase the intensity of Recursive Strikes.}
  • max_stacks:15
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Shadow Blades 2.1 0.0 180.2sec 180.3sec 32.95% 36.56% 0.0(0.0) 2.0

Buff details

  • buff initial source:NF+DoS
  • cooldown name:buff_shadow_blades
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • shadow_blades_1:32.95%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:121471
  • name:Shadow Blades
  • tooltip:Autoattacks deal pure Shadow damage. Combo-point-generating attacks generate {$s2=1} additional combo point.
  • description:Draws upon surrounding shadows to empower your weapons, causing auto attacks to deal Shadow damage and abilities that generate combo points to generate 1 additional combo point. Lasts {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Shadow Dance 25.8 0.0 11.6sec 11.6sec 42.71% 42.71% 0.0(0.0) 25.5

Buff details

  • buff initial source:NF+DoS
  • cooldown name:buff_shadow_dance
  • max_stacks:1
  • duration:5.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • shadow_dance_1:42.71%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:185313
  • name:Shadow Dance
  • tooltip:
  • description:Allows use of all Stealth abilities and grants all the combat benefits of Stealth for {$d=3 seconds}. Effect not broken from taking damage or attacking. {$?s14062=false}[Movement speed while active is increased by {$1784s3=0}% and damage dealt is increased by {$1784s4=0}%. ]?s108209[Abilities cost {$112942s1=75}% less while active. ][]{$?s31223=false}[Attacks from Shadow Dance and for {$31223s1=5} sec after deal {$31665s1=10}% more damage. ][]
  • max_stacks:0
  • duration:3.00
  • cooldown:1.00
  • default_chance:0.00%
Sprint 2.7 0.0 122.3sec 122.3sec 7.11% 7.11% 85.8(85.8) 2.7

Buff details

  • buff initial source:NF+DoS
  • cooldown name:buff_sprint
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • sprint_1:7.11%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2983
  • name:Sprint
  • tooltip:Movement speed increased by $w1%.
  • description:Increases your movement speed by {$s1=70}% for {$d=8 seconds}. Usable while stealthed.
  • max_stacks:0
  • duration:8.00
  • cooldown:120.00
  • default_chance:0.00%
Stealth 6.4 0.0 45.4sec 51.8sec 2.04% 2.04% 0.0(0.0) 0.0

Buff details

  • buff initial source:NF+DoS
  • cooldown name:buff_stealth
  • max_stacks:1
  • duration:150.00
  • cooldown:2.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stealth_1:2.04%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:1784
  • name:Stealth
  • tooltip:Stealthed.$?$w3!=0[ Movement speed increased by $w3%.][]$?$w4!=0[ Damage increased by $w4%.][]
  • description:Conceals you in the shadows until cancelled, allowing you to stalk enemies without being seen. {$?s14062=false}[Movement speed while stealthed is increased by {$s3=0}% and damage dealt is increased by {$s4=0}%.]?s108209[ Abilities cost {$112942s1=75}% less while stealthed. ][]{$?s31223=false}[ Attacks from Stealth and for {$31223s1=5} sec after deal {$31665s1=10}% more damage.][]
  • max_stacks:0
  • duration:-0.00
  • cooldown:2.00
  • default_chance:100.00%
Subterfuge 6.5 0.0 44.5sec 44.5sec 6.47% 6.47% 0.0(0.0) 6.4

Buff details

  • buff initial source:NF+DoS
  • cooldown name:buff_subterfuge
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • subterfuge_1:6.47%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:115192
  • name:Subterfuge
  • tooltip:Temporarily concealed in the shadows.
  • description:{$@spelldesc108208=Your abilities requiring Stealth can still be used for {$115192d=3 seconds} after Stealth breaks.$?c3[ Also increases the duration of Shadow Dance by ${$m2/1000} sec.][ Also causes Garrote to deal {$115192s2=125}% increased damage and have no cooldown when used from Stealth or {$115192d=3 seconds} after Stealth breaks.]}
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
Symbols of Death 1.2 12.4 195.6sec 23.3sec 99.80% 99.27% 12.4(12.4) 0.2

Buff details

  • buff initial source:NF+DoS
  • cooldown name:buff_symbols_of_death
  • max_stacks:1
  • duration:35.00
  • cooldown:10.00
  • default_chance:100.00%
  • default_value:1.20

Stack Uptimes

  • symbols_of_death_1:99.80%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:212283
  • name:Symbols of Death
  • tooltip:All damage done increased by {$s1=20}%.
  • description:Invoke ancient symbols of power, increasing all damage you deal by {$s1=20}% for {$d=35 seconds}, and causing your next Shadowstrike to critically strike. Unaffected by the global cooldown.
  • max_stacks:0
  • duration:35.00
  • cooldown:10.00
  • default_chance:0.00%
Temptation 1.9 4.0 175.4sec 44.2sec 37.24% 66.67% 0.0(0.0) 1.4

Buff details

  • buff initial source:NF+DoS
  • cooldown name:buff_temptation
  • max_stacks:10
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • temptation_1:9.95%
  • temptation_2:10.09%
  • temptation_3:9.73%
  • temptation_4:7.38%
  • temptation_5:0.15%
  • temptation_6:0.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:234143
  • name:Temptation
  • tooltip:Increased chance for your Ring of Collapsing Futures to incur a {$s1=5} min cooldown.
  • description:{$@spelldesc234142=Deal {$s1=40000} Shadow damage to an enemy.}
  • max_stacks:10
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Vanish 5.5 0.0 51.7sec 51.7sec 5.45% 5.45% 0.0(0.0) 5.4

Buff details

  • buff initial source:NF+DoS
  • cooldown name:buff_vanish
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • vanish_1:5.45%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:11327
  • name:Vanish
  • tooltip:Improved stealth.$?$w3!=0[ Movement speed increased by $w3%.][]$?$w4!=0[ Damage increased by $w4%.][]
  • description:
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:NF+DoS
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Seventh Demon

Buff details

  • buff initial source:NF+DoS
  • cooldown name:buff_flask_of_the_seventh_demon
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:1300.00

Stack Uptimes

  • flask_of_the_seventh_demon_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188033
  • name:Flask of the Seventh Demon
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (seedbattered_fish_plate)

Buff details

  • buff initial source:NF+DoS
  • cooldown name:buff_seedbattered_fish_plate
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:versatility_rating
  • amount:375.00

Stack Uptimes

  • seedbattered_fish_plate_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225605
  • name:Well Fed
  • tooltip:Versatility increased by $w1.
  • description:Increases versatility by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
NF+DoS
backstab Energy 52.9 1850.6 35.0 35.0 4589.2
eviscerate Energy 52.4 1832.3 35.0 35.0 25522.5
eviscerate Combo Points 52.4 290.7 5.6 5.6 160881.2
nightblade Energy 16.9 423.6 25.0 25.0 77835.1
nightblade Combo Points 16.9 94.1 5.6 5.6 350383.7
shadowstrike Energy 101.6 4063.3 40.0 40.0 10099.8
symbols_of_death Energy 13.6 440.3 32.4 32.4 0.0
Resource Gains Type Count Total Average Overflow
backstab Combo Points 52.87 52.87 (13.64%) 1.00 0.00 0.00%
goremaws_bite Combo Points 4.65 13.77 (3.55%) 2.96 0.17 1.23%
shadowstrike Combo Points 101.58 203.16 (52.41%) 2.00 0.00 0.00%
energy_regen Energy 1166.53 3377.92 (39.50%) 2.90 154.82 4.38%
Shadow Techniques Combo Points 73.26 73.30 (18.91%) 1.00 14.65 16.65%
Master of Shadows Energy 36.79 773.38 (9.04%) 21.02 146.48 15.92%
Shadow Blades Combo Points 53.35 44.56 (11.49%) 0.84 8.79 16.48%
Energetic Stabbing Energy 25.34 633.48 (7.41%) 25.00 0.00 0.00%
Goremaw's Bite Energy 27.47 131.84 (1.54%) 4.80 5.49 4.00%
Relentless Strikes Energy 69.30 3024.90 (35.37%) 43.65 51.70 1.68%
Shadow Satyr's Walk Energy 101.58 609.49 (7.13%) 6.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Energy 28.38 28.58
Combo Points 1.29 1.28
Combat End Resource Mean Min Max
Energy 41.69 6.12 100.00
Combo Points 2.82 0.00 6.00

Benefits & Uptimes

Benefits %
Uptimes %
Energy Cap 3.0%

Statistics & Data Analysis

Fight Length
Sample Data NF+DoS Fight Length
Count 4999
Mean 301.28
Minimum 222.03
Maximum 381.32
Spread ( max - min ) 159.29
Range [ ( max - min ) / 2 * 100% ] 26.44%
DPS
Sample Data NF+DoS Damage Per Second
Count 4999
Mean 583300.83
Minimum 496896.19
Maximum 684200.30
Spread ( max - min ) 187304.11
Range [ ( max - min ) / 2 * 100% ] 16.06%
Standard Deviation 26443.4043
5th Percentile 541578.27
95th Percentile 628163.74
( 95th Percentile - 5th Percentile ) 86585.47
Mean Distribution
Standard Deviation 374.0036
95.00% Confidence Intervall ( 582567.80 - 584033.87 )
Normalized 95.00% Confidence Intervall ( 99.87% - 100.13% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 79
0.1% Error 7895
0.1 Scale Factor Error with Delta=300 5969232
0.05 Scale Factor Error with Delta=300 23876925
0.01 Scale Factor Error with Delta=300 596923119
Priority Target DPS
Sample Data NF+DoS Priority Target Damage Per Second
Count 4999
Mean 583300.83
Minimum 496896.19
Maximum 684200.30
Spread ( max - min ) 187304.11
Range [ ( max - min ) / 2 * 100% ] 16.06%
Standard Deviation 26443.4043
5th Percentile 541578.27
95th Percentile 628163.74
( 95th Percentile - 5th Percentile ) 86585.47
Mean Distribution
Standard Deviation 374.0036
95.00% Confidence Intervall ( 582567.80 - 584033.87 )
Normalized 95.00% Confidence Intervall ( 99.87% - 100.13% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 79
0.1% Error 7895
0.1 Scale Factor Error with Delta=300 5969232
0.05 Scale Factor Error with Delta=300 23876925
0.01 Scale Factor Error with Delta=300 596923119
DPS(e)
Sample Data NF+DoS Damage Per Second (Effective)
Count 4999
Mean 583300.83
Minimum 496896.19
Maximum 684200.30
Spread ( max - min ) 187304.11
Range [ ( max - min ) / 2 * 100% ] 16.06%
Damage
Sample Data NF+DoS Damage
Count 4999
Mean 175167777.18
Minimum 125802840.38
Maximum 228334061.36
Spread ( max - min ) 102531220.97
Range [ ( max - min ) / 2 * 100% ] 29.27%
DTPS
Sample Data NF+DoS Damage Taken Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data NF+DoS Healing Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data NF+DoS Healing Per Second (Effective)
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data NF+DoS Heal
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data NF+DoS Healing Taken Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data NF+DoS Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data NF+DoSTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data NF+DoS Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,name=flask_of_the_seventh_demon
1 0.00 augmentation,name=defiled
2 0.00 food,name=seedbattered_fish_plate
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 stealth
5 0.00 potion,name=old_war
6 0.00 marked_for_death,if=raid_event.adds.in>40
7 0.00 variable,name=ssw_refund,value=equipped.shadow_satyrs_walk*(4+ssw_refund_offset)
Defined variables that doesn't change during the fight
8 0.00 variable,name=stealth_threshold,value=(15+talent.vigor.enabled*35+talent.master_of_shadows.enabled*30+variable.ssw_refund)
9 0.00 enveloping_shadows,if=combo_points>=5
A 0.00 symbols_of_death
Default action list Executed every time the actor is available.
# count action,conditions
B 0.00 call_action_list,name=cds
C 0.00 run_action_list,name=stealthed,if=stealthed.all
Fully switch to the Stealthed Rotation (by doing so, it forces pooling if nothing is available)
D 0.00 call_action_list,name=finish,if=combo_points>=5|(combo_points>=4&spell_targets.shuriken_storm>=3&spell_targets.shuriken_storm<=4)
E 0.00 call_action_list,name=stealth_als,if=combo_points.deficit>=2+talent.premeditation.enabled
F 0.00 call_action_list,name=build,if=energy.deficit<=variable.stealth_threshold
actions.build Builders
# count action,conditions
0.00 shuriken_storm,if=spell_targets.shuriken_storm>=2
0.00 gloomblade
G 52.87 backstab
actions.cds Cooldowns
# count action,conditions
H 1.00 potion,name=old_war,if=buff.bloodlust.react|target.time_to_die<=25|buff.shadow_blades.up
I 5.91 use_item,slot=finger2,if=(buff.shadow_blades.up&stealthed.rogue)|target.time_to_die<20
J 2.77 use_item,slot=trinket2,if=(buff.shadow_blades.up&stealthed.rogue)|target.time_to_die<20
0.00 blood_fury,if=stealthed.rogue
0.00 berserking,if=stealthed.rogue
0.00 arcane_torrent,if=stealthed.rogue&energy.deficit>70
K 2.10 shadow_blades,if=combo_points<=2|(equipped.denial_of_the_halfgiants&combo_points>=1)
L 4.65 goremaws_bite,if=!stealthed.all&cooldown.shadow_dance.charges_fractional<=2.45&((combo_points.deficit>=4-(time<10)*2&energy.deficit>50+talent.vigor.enabled*25-(time>=10)*15)|target.time_to_die<8)
0.00 marked_for_death,target_if=min:target.time_to_die,if=target.time_to_die<combo_points.deficit|(raid_event.adds.in>40&combo_points.deficit>=4+talent.deeper_strategem.enabled+talent.anticipation.enabled)
actions.finish Finishers
# count action,conditions
0.00 enveloping_shadows,if=buff.enveloping_shadows.remains<target.time_to_die&buff.enveloping_shadows.remains<=combo_points*1.8
0.00 death_from_above,if=spell_targets.death_from_above>=6
M 16.94 nightblade,cycle_targets=1,if=target.time_to_die>8&((refreshable&(!finality|buff.finality_nightblade.up))|remains<tick_time)
0.00 death_from_above
N 52.35 eviscerate
actions.stealth_cds Stealth Cooldowns
# count action,conditions
S 3.79 shadow_dance,if=charges_fractional>=2.45
T 2.80 vanish
U 2.71 sprint_offensive
V 4.24 shadow_dance,if=charges>=2&combo_points<=1
0.00 pool_resource,for_next=1,extra_amount=40
0.00 shadowmeld,if=energy>=40&energy.deficit>=10+variable.ssw_refund
W 17.81 shadow_dance,if=combo_points<=1
actions.stealthed Stealthed Rotation
# count action,conditions
X 12.58 symbols_of_death,if=(buff.symbols_of_death.remains<target.time_to_die-4&buff.symbols_of_death.remains<=buff.symbols_of_death.duration*0.3)|equipped.shadow_satyrs_walk&energy.time_to_max<0.25
Y 0.00 call_action_list,name=finish,if=combo_points>=5
0.00 shuriken_storm,if=buff.shadowmeld.down&((combo_points.deficit>=3&spell_targets.shuriken_storm>=2+talent.premeditation.enabled+equipped.shadow_satyrs_walk)|buff.the_dreadlords_deceit.stack>=29)
Z 101.58 shadowstrike

Sample Sequence

0124578AKIJZZMSZZNZXZNTZZNSIZZNZZMGUGGNXZZNSZZINZZNLGNSXZNZZMVZZNIZZNGGGNGGGMSZZNXZZNVZZNZZGNVZZZMZGNWZZNZGGMWZZNXLGNWZZNZZGMWZZNZZNGGGNGWZZMZXZNGTZNZGGNWZZNZZMUGGZZNWXZZMZGGNLGGNWZZNXZZGNGGKHGMWIJXZZNGGMWZZNIZZNGGNWZZNZZNGGNWIZZMXZZNGGNWZZNZZNLGGMWZZNZZGNGGGNTZZZMWXZZNZGUGMXZZGNIJGGNWZZNZZNWZZZINLG

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask NF+DoS 100.0/100: 100% energy | 0.0/6: 0% combo_points
Pre precombat 1 augmentation NF+DoS 100.0/100: 100% energy | 0.0/6: 0% combo_points
Pre precombat 2 food NF+DoS 100.0/100: 100% energy | 0.0/6: 0% combo_points
Pre precombat 4 stealth Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, stealth
Pre precombat 5 potion Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, stealth, potion_of_the_old_war
Pre precombat 7 ssw_refund Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, stealth, potion_of_the_old_war
Pre precombat 8 stealth_threshold Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, stealth, potion_of_the_old_war
Pre precombat A symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, stealth, symbols_of_death, death, potion_of_the_old_war
0:00.000 cds K shadow_blades Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, stealth, symbols_of_death, death, potion_of_the_old_war
0:00.000 cds I use_item_ring_of_collapsing_futures Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, stealth, symbols_of_death, shadow_blades, death, potion_of_the_old_war
0:00.000 cds J use_item_draught_of_souls Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points temptation, master_of_subtlety_aura, stealth, symbols_of_death, shadow_blades, death, potion_of_the_old_war
0:03.000 stealthed Z shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points bloodlust, temptation, master_of_subtlety_aura, stealth, symbols_of_death, shadow_blades, death, potion_of_the_old_war
0:04.005 stealthed Z shadowstrike Fluffy_Pillow 80.7/100: 81% energy | 3.0/6: 50% combo_points bloodlust, temptation, master_of_subtlety_aura, stealth, subterfuge, symbols_of_death, shadow_blades, recursive_strikes, potion_of_the_old_war
0:05.009 finish M nightblade Fluffy_Pillow 61.5/100: 61% energy | 6.0/6: 100% combo_points bloodlust, temptation, master_of_subtlety_aura, stealth, subterfuge, symbols_of_death, shadow_blades, recursive_strikes(3), potion_of_the_old_war
0:06.013 stealth_cds S shadow_dance Fluffy_Pillow 91.2/100: 91% energy | 0.0/6: 0% combo_points bloodlust, temptation, master_of_subtlety, symbols_of_death, shadow_blades, finality_nightblade(6), recursive_strikes(5), potion_of_the_old_war
0:06.013 stealthed Z shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points bloodlust, temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6), recursive_strikes(5), potion_of_the_old_war
0:07.017 stealthed Z shadowstrike Fluffy_Pillow 80.7/100: 81% energy | 4.0/6: 67% combo_points bloodlust, temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6), recursive_strikes(7), potion_of_the_old_war
0:08.022 finish N eviscerate Fluffy_Pillow 86.5/100: 86% energy | 6.0/6: 100% combo_points bloodlust, temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6), recursive_strikes(9), potion_of_the_old_war
0:09.027 stealthed Z shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points bloodlust, temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6), recursive_strikes(9), potion_of_the_old_war
0:10.032 stealthed X symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 4.0/6: 67% combo_points bloodlust, temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6), recursive_strikes(11), potion_of_the_old_war
0:10.032 stealthed Z shadowstrike Fluffy_Pillow 65.0/100: 65% energy | 4.0/6: 67% combo_points bloodlust, temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, death, finality_eviscerate(6), finality_nightblade(6), recursive_strikes(11), potion_of_the_old_war
0:11.037 finish N eviscerate Fluffy_Pillow 45.7/100: 46% energy | 6.0/6: 100% combo_points bloodlust, temptation, master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6), recursive_strikes(13), potion_of_the_old_war
0:12.042 stealth_cds T vanish Fluffy_Pillow 65.5/100: 65% energy | 1.0/6: 17% combo_points bloodlust, temptation, master_of_subtlety, symbols_of_death, shadow_blades, finality_nightblade(6), recursive_strikes(15), potion_of_the_old_war
0:12.042 stealthed Z shadowstrike Fluffy_Pillow 90.5/100: 90% energy | 1.0/6: 17% combo_points bloodlust, temptation, master_of_subtlety_aura, vanish, symbols_of_death, shadow_blades, finality_nightblade(6), recursive_strikes(15), potion_of_the_old_war
0:13.046 stealthed Z shadowstrike Fluffy_Pillow 96.2/100: 96% energy | 4.0/6: 67% combo_points bloodlust, temptation, master_of_subtlety_aura, vanish, subterfuge, symbols_of_death, shadow_blades, finality_nightblade(6), recursive_strikes(15), potion_of_the_old_war
0:14.048 finish N eviscerate Fluffy_Pillow 76.9/100: 77% energy | 6.0/6: 100% combo_points bloodlust, temptation, master_of_subtlety_aura, vanish, subterfuge, symbols_of_death, shadow_blades, finality_nightblade(6), recursive_strikes(15), potion_of_the_old_war
0:15.052 stealth_cds S shadow_dance Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points bloodlust, temptation, master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6), recursive_strikes(15), potion_of_the_old_war
0:15.052 cds I use_item_ring_of_collapsing_futures Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points bloodlust, temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6), recursive_strikes(15), potion_of_the_old_war
0:15.052 stealthed Z shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points bloodlust, temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6), recursive_strikes(15), potion_of_the_old_war
0:16.055 stealthed Z shadowstrike Fluffy_Pillow 80.7/100: 81% energy | 4.0/6: 67% combo_points bloodlust, temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6), recursive_strikes(15), potion_of_the_old_war
0:17.060 finish N eviscerate Fluffy_Pillow 61.5/100: 61% energy | 6.0/6: 100% combo_points bloodlust, temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6), recursive_strikes(15), potion_of_the_old_war
0:18.063 stealthed Z shadowstrike Fluffy_Pillow 81.2/100: 81% energy | 0.0/6: 0% combo_points bloodlust, temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6), recursive_strikes(15), potion_of_the_old_war
0:19.068 stealthed Z shadowstrike Fluffy_Pillow 86.9/100: 87% energy | 3.0/6: 50% combo_points bloodlust, temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6), recursive_strikes(15), potion_of_the_old_war
0:20.073 finish M nightblade Fluffy_Pillow 92.7/100: 93% energy | 6.0/6: 100% combo_points bloodlust, temptation(2), master_of_subtlety, symbols_of_death, shadow_blades, finality_nightblade(6), recursive_strikes(15), potion_of_the_old_war
0:21.077 build G backstab Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points bloodlust, temptation(2), master_of_subtlety, symbols_of_death, shadow_blades, recursive_strikes(15), potion_of_the_old_war
0:22.080 stealth_cds U sprint Fluffy_Pillow 79.7/100: 80% energy | 2.0/6: 33% combo_points bloodlust, temptation(2), master_of_subtlety, symbols_of_death, shadow_blades, recursive_strikes(15), potion_of_the_old_war
0:22.080 build G backstab Fluffy_Pillow 79.7/100: 80% energy | 2.0/6: 33% combo_points bloodlust, temptation(2), master_of_subtlety, sprint, symbols_of_death, shadow_blades, faster_than_light_trigger, recursive_strikes(15), potion_of_the_old_war
0:23.084 build G backstab Fluffy_Pillow 59.5/100: 59% energy | 4.0/6: 67% combo_points bloodlust, temptation(2), master_of_subtlety, sprint, symbols_of_death, shadow_blades, faster_than_light_trigger, recursive_strikes(15)
0:24.089 finish N eviscerate Fluffy_Pillow 39.2/100: 39% energy | 6.0/6: 100% combo_points bloodlust, temptation(2), master_of_subtlety, sprint, symbols_of_death, shadow_blades, faster_than_light_trigger, recursive_strikes(15)
0:25.094 stealthed X symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points bloodlust, temptation(2), master_of_subtlety_aura, vanish, subterfuge, sprint, symbols_of_death, shadow_blades, finality_eviscerate(6), recursive_strikes(15)
0:25.094 stealthed Z shadowstrike Fluffy_Pillow 65.0/100: 65% energy | 1.0/6: 17% combo_points bloodlust, temptation(2), master_of_subtlety_aura, vanish, subterfuge, sprint, symbols_of_death, shadow_blades, death, finality_eviscerate(6), recursive_strikes(15)
0:26.098 stealthed Z shadowstrike Fluffy_Pillow 45.7/100: 46% energy | 4.0/6: 67% combo_points bloodlust, temptation(2), master_of_subtlety_aura, vanish, subterfuge, sprint, symbols_of_death, shadow_blades, finality_eviscerate(6), recursive_strikes(15)
0:27.106 Waiting     0.600 sec 26.5/100: 27% energy | 6.0/6: 100% combo_points bloodlust, temptation(2), master_of_subtlety_aura, vanish, subterfuge, sprint, symbols_of_death, shadow_blades, finality_eviscerate(6), recursive_strikes(15)
0:27.706 finish N eviscerate Fluffy_Pillow 35.3/100: 35% energy | 6.0/6: 100% combo_points bloodlust, temptation(2), master_of_subtlety_aura, vanish, subterfuge, sprint, symbols_of_death, shadow_blades, finality_eviscerate(6), recursive_strikes(15)
0:28.711 stealth_cds S shadow_dance Fluffy_Pillow 80.1/100: 80% energy | 0.0/6: 0% combo_points bloodlust, temptation(2), master_of_subtlety, sprint, symbols_of_death, shadow_blades
0:28.711 stealthed Z shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points bloodlust, temptation(2), master_of_subtlety_aura, shadow_dance, sprint, symbols_of_death, shadow_blades
0:29.715 stealthed Z shadowstrike Fluffy_Pillow 80.7/100: 81% energy | 3.0/6: 50% combo_points bloodlust, temptation(2), master_of_subtlety_aura, shadow_dance, sprint, symbols_of_death, shadow_blades
0:30.719 cds I use_item_ring_of_collapsing_futures Fluffy_Pillow 61.5/100: 61% energy | 6.0/6: 100% combo_points bloodlust, temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades
0:30.719 finish N eviscerate Fluffy_Pillow 61.5/100: 61% energy | 6.0/6: 100% combo_points bloodlust, temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades
0:31.725 stealthed Z shadowstrike Fluffy_Pillow 81.2/100: 81% energy | 1.0/6: 17% combo_points bloodlust, temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6)
0:32.730 stealthed Z shadowstrike Fluffy_Pillow 62.0/100: 62% energy | 4.0/6: 67% combo_points bloodlust, temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6)
0:33.735 finish N eviscerate Fluffy_Pillow 42.7/100: 43% energy | 6.0/6: 100% combo_points bloodlust, temptation(3), master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6)
0:34.741 cds L goremaws_bite Fluffy_Pillow 62.5/100: 62% energy | 0.0/6: 0% combo_points bloodlust, temptation(3), master_of_subtlety, symbols_of_death, shadow_blades
0:35.745 build G backstab Fluffy_Pillow 82.2/100: 82% energy | 3.0/6: 50% combo_points bloodlust, temptation(3), master_of_subtlety, symbols_of_death, shadow_blades, goremaws_bite
0:36.749 finish N eviscerate Fluffy_Pillow 67.0/100: 67% energy | 6.0/6: 100% combo_points bloodlust, temptation(3), master_of_subtlety, symbols_of_death, shadow_blades, goremaws_bite
0:37.753 stealth_cds S shadow_dance Fluffy_Pillow 91.7/100: 92% energy | 0.0/6: 0% combo_points bloodlust, temptation(3), master_of_subtlety, symbols_of_death, shadow_blades, goremaws_bite, finality_eviscerate(6)
0:37.753 stealthed X symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points bloodlust, temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, goremaws_bite, finality_eviscerate(6)
0:37.753 stealthed Z shadowstrike Fluffy_Pillow 65.0/100: 65% energy | 0.0/6: 0% combo_points bloodlust, temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, goremaws_bite, death, finality_eviscerate(6)
0:38.758 finish N eviscerate Fluffy_Pillow 50.7/100: 51% energy | 5.0/6: 83% combo_points bloodlust, temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, goremaws_bite, finality_eviscerate(6)
0:39.761 stealthed Z shadowstrike Fluffy_Pillow 75.5/100: 75% energy | 0.0/6: 0% combo_points bloodlust, temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, goremaws_bite
0:40.767 stealthed Z shadowstrike Fluffy_Pillow 61.2/100: 61% energy | 3.0/6: 50% combo_points bloodlust, temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades
0:41.773 finish M nightblade Fluffy_Pillow 38.6/100: 39% energy | 6.0/6: 100% combo_points temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades
0:42.778 stealth_cds V shadow_dance Fluffy_Pillow 64.9/100: 65% energy | 0.0/6: 0% combo_points temptation(3), master_of_subtlety, symbols_of_death, shadow_blades, finality_nightblade(6)
0:42.778 stealthed Z shadowstrike Fluffy_Pillow 89.9/100: 90% energy | 0.0/6: 0% combo_points temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6)
0:43.782 stealthed Z shadowstrike Fluffy_Pillow 92.3/100: 92% energy | 3.0/6: 50% combo_points temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6)
0:44.786 finish N eviscerate Fluffy_Pillow 94.6/100: 95% energy | 6.0/6: 100% combo_points temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6)
0:45.790 cds I use_item_ring_of_collapsing_futures Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6)
0:45.790 stealthed Z shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6)
0:46.796 stealthed Z shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 3.0/6: 50% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6)
0:47.801 finish N eviscerate Fluffy_Pillow 77.3/100: 77% energy | 6.0/6: 100% combo_points temptation(4), master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6)
0:48.805 build G backstab Fluffy_Pillow 93.7/100: 94% energy | 0.0/6: 0% combo_points temptation(4), master_of_subtlety, symbols_of_death, shadow_blades, finality_nightblade(6)
0:49.809 build G backstab Fluffy_Pillow 70.0/100: 70% energy | 2.0/6: 33% combo_points temptation(4), master_of_subtlety, symbols_of_death, shadow_blades, finality_nightblade(6)
0:50.812 Waiting     0.500 sec 46.3/100: 46% energy | 4.0/6: 67% combo_points temptation(4), master_of_subtlety, symbols_of_death, shadow_blades, finality_nightblade(6)
0:51.312 build G backstab Fluffy_Pillow 52.0/100: 52% energy | 4.0/6: 67% combo_points temptation(4), master_of_subtlety, symbols_of_death, shadow_blades, finality_nightblade(6)
0:52.318 Waiting     0.600 sec 28.3/100: 28% energy | 6.0/6: 100% combo_points temptation(4), master_of_subtlety, symbols_of_death, finality_nightblade(6)
0:52.918 finish N eviscerate Fluffy_Pillow 35.1/100: 35% energy | 6.0/6: 100% combo_points temptation(4), symbols_of_death, finality_nightblade(6)
0:53.922 build G backstab Fluffy_Pillow 91.4/100: 91% energy | 2.0/6: 33% combo_points temptation(4), symbols_of_death, finality_eviscerate(6), finality_nightblade(6)
0:54.926 build G backstab Fluffy_Pillow 67.8/100: 68% energy | 3.0/6: 50% combo_points temptation(4), symbols_of_death, finality_eviscerate(6), finality_nightblade(6)
0:55.929 Waiting     0.700 sec 44.1/100: 44% energy | 4.0/6: 67% combo_points temptation(4), symbols_of_death, finality_eviscerate(6), finality_nightblade(6)
0:56.629 build G backstab Fluffy_Pillow 52.0/100: 52% energy | 4.0/6: 67% combo_points temptation(4), symbols_of_death, finality_eviscerate(6), finality_nightblade(6)
0:57.634 finish M nightblade Fluffy_Pillow 28.3/100: 28% energy | 5.0/6: 83% combo_points temptation(4), symbols_of_death, finality_eviscerate(6), finality_nightblade(6)
0:58.639 stealth_cds S shadow_dance Fluffy_Pillow 54.7/100: 55% energy | 1.0/6: 17% combo_points temptation(4), symbols_of_death, finality_eviscerate(6)
0:58.639 stealthed Z shadowstrike Fluffy_Pillow 79.7/100: 80% energy | 1.0/6: 17% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6)
0:59.643 stealthed Z shadowstrike Fluffy_Pillow 82.0/100: 82% energy | 3.0/6: 50% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6)
1:00.647 finish N eviscerate Fluffy_Pillow 84.4/100: 84% energy | 5.0/6: 83% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6)
1:01.651 stealthed X symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death
1:01.651 stealthed Z shadowstrike Fluffy_Pillow 65.0/100: 65% energy | 0.0/6: 0% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death, death
1:02.655 stealthed Z shadowstrike Fluffy_Pillow 42.3/100: 42% energy | 3.0/6: 50% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death
1:03.660 finish N eviscerate Fluffy_Pillow 44.7/100: 45% energy | 5.0/6: 83% combo_points temptation(4), master_of_subtlety, symbols_of_death
1:04.663 stealth_cds V shadow_dance Fluffy_Pillow 61.0/100: 61% energy | 0.0/6: 0% combo_points temptation(4), master_of_subtlety, symbols_of_death, finality_eviscerate(5)
1:04.663 stealthed Z shadowstrike Fluffy_Pillow 86.0/100: 86% energy | 0.0/6: 0% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5)
1:05.667 stealthed Z shadowstrike Fluffy_Pillow 63.3/100: 63% energy | 2.0/6: 33% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5)
1:06.672 finish N eviscerate Fluffy_Pillow 40.7/100: 41% energy | 5.0/6: 83% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5)
1:07.675 stealthed Z shadowstrike Fluffy_Pillow 57.0/100: 57% energy | 0.0/6: 0% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death
1:08.679 Waiting     0.600 sec 34.3/100: 34% energy | 2.0/6: 33% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death
1:09.279 stealthed Z shadowstrike Fluffy_Pillow 41.1/100: 41% energy | 2.0/6: 33% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death
1:10.283 Waiting     0.700 sec 43.4/100: 43% energy | 4.0/6: 67% combo_points temptation(4), master_of_subtlety, symbols_of_death
1:10.983 build G backstab Fluffy_Pillow 51.3/100: 51% energy | 4.0/6: 67% combo_points temptation(4), master_of_subtlety, symbols_of_death
1:11.988 Waiting     0.700 sec 27.7/100: 28% energy | 6.0/6: 100% combo_points temptation(4), master_of_subtlety, symbols_of_death
1:12.688 finish N eviscerate Fluffy_Pillow 35.6/100: 36% energy | 6.0/6: 100% combo_points temptation(4), master_of_subtlety, symbols_of_death
1:13.693 stealth_cds V shadow_dance Fluffy_Pillow 51.9/100: 52% energy | 0.0/6: 0% combo_points temptation(4), master_of_subtlety, symbols_of_death, finality_eviscerate(6)
1:13.693 stealthed Z shadowstrike Fluffy_Pillow 76.9/100: 77% energy | 0.0/6: 0% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6)
1:14.698 stealthed Z shadowstrike Fluffy_Pillow 79.3/100: 79% energy | 2.0/6: 33% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6)
1:15.704 stealthed Z shadowstrike Fluffy_Pillow 56.6/100: 57% energy | 4.0/6: 67% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6)
1:16.709 finish M nightblade Fluffy_Pillow 34.0/100: 34% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6)
1:17.714 stealthed Z shadowstrike Fluffy_Pillow 60.3/100: 60% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6), finality_nightblade(6)
1:18.718 Waiting     1.200 sec 37.7/100: 38% energy | 2.0/6: 33% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(6), finality_nightblade(6)
1:19.918 build G backstab Fluffy_Pillow 51.2/100: 51% energy | 2.0/6: 33% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(6), finality_nightblade(6)
1:20.922 Waiting     0.700 sec 27.5/100: 28% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(6), finality_nightblade(6)
1:21.622 finish N eviscerate Fluffy_Pillow 35.4/100: 35% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(6), finality_nightblade(6)
1:22.625 stealth_cds W shadow_dance Fluffy_Pillow 51.8/100: 52% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, finality_nightblade(6)
1:22.625 stealthed Z shadowstrike Fluffy_Pillow 76.8/100: 77% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(6)
1:23.630 stealthed Z shadowstrike Fluffy_Pillow 54.1/100: 54% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(6)
1:24.637 Waiting     0.400 sec 31.5/100: 31% energy | 5.0/6: 83% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(6)
1:25.037 finish N eviscerate Fluffy_Pillow 36.0/100: 36% energy | 5.0/6: 83% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(6)
1:26.040 stealthed Z shadowstrike Fluffy_Pillow 52.3/100: 52% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5), finality_nightblade(6)
1:27.043 Waiting     1.900 sec 29.6/100: 30% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5), finality_nightblade(6)
1:28.943 build G backstab Fluffy_Pillow 51.1/100: 51% energy | 3.0/6: 50% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5), finality_nightblade(6)
1:29.947 Waiting     2.100 sec 27.4/100: 27% energy | 4.0/6: 67% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5), finality_nightblade(6)
1:32.047 build G backstab Fluffy_Pillow 51.1/100: 51% energy | 4.0/6: 67% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5), finality_nightblade(6)
1:33.054 finish M nightblade Fluffy_Pillow 27.5/100: 27% energy | 5.0/6: 83% combo_points symbols_of_death, finality_eviscerate(5), finality_nightblade(6)
1:34.060 stealth_cds W shadow_dance Fluffy_Pillow 53.8/100: 54% energy | 1.0/6: 17% combo_points symbols_of_death, finality_eviscerate(5)
1:34.060 stealthed Z shadowstrike Fluffy_Pillow 78.8/100: 79% energy | 1.0/6: 17% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5)
1:35.064 stealthed Z shadowstrike Fluffy_Pillow 56.2/100: 56% energy | 3.0/6: 50% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5)
1:36.069 Waiting     0.200 sec 33.5/100: 34% energy | 5.0/6: 83% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5)
1:36.269 finish N eviscerate Fluffy_Pillow 35.8/100: 36% energy | 5.0/6: 83% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5)
1:37.275 stealthed X symbols_of_death Fluffy_Pillow 52.1/100: 52% energy | 1.0/6: 17% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
1:37.275 Waiting     1.796 sec 17.1/100: 17% energy | 1.0/6: 17% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, death
1:39.071 cds L goremaws_bite Fluffy_Pillow 37.4/100: 37% energy | 1.0/6: 17% combo_points master_of_subtlety, symbols_of_death, death
1:40.076 build G backstab Fluffy_Pillow 53.8/100: 54% energy | 4.0/6: 67% combo_points master_of_subtlety, symbols_of_death, goremaws_bite, death
1:41.080 finish N eviscerate Fluffy_Pillow 35.1/100: 35% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death, goremaws_bite, death
1:42.086 stealth_cds W shadow_dance Fluffy_Pillow 56.4/100: 56% energy | 1.0/6: 17% combo_points master_of_subtlety, symbols_of_death, goremaws_bite, death, finality_eviscerate(5)
1:42.086 stealthed Z shadowstrike Fluffy_Pillow 81.4/100: 81% energy | 1.0/6: 17% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, goremaws_bite, death, finality_eviscerate(5)
1:43.093 stealthed Z shadowstrike Fluffy_Pillow 88.8/100: 89% energy | 3.0/6: 50% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, goremaws_bite, finality_eviscerate(5)
1:44.098 finish N eviscerate Fluffy_Pillow 71.2/100: 71% energy | 5.0/6: 83% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, goremaws_bite, finality_eviscerate(5)
1:45.101 stealthed Z shadowstrike Fluffy_Pillow 92.5/100: 92% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
1:46.107 stealthed Z shadowstrike Fluffy_Pillow 69.8/100: 70% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
1:47.111 Waiting     0.400 sec 47.2/100: 47% energy | 4.0/6: 67% combo_points master_of_subtlety, symbols_of_death
1:47.511 build G backstab Fluffy_Pillow 51.7/100: 52% energy | 4.0/6: 67% combo_points master_of_subtlety, symbols_of_death
1:48.516 Waiting     0.200 sec 28.0/100: 28% energy | 6.0/6: 100% combo_points master_of_subtlety, symbols_of_death
1:48.716 finish M nightblade Fluffy_Pillow 30.3/100: 30% energy | 6.0/6: 100% combo_points master_of_subtlety, symbols_of_death
1:49.721 stealth_cds W shadow_dance Fluffy_Pillow 56.6/100: 57% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, finality_nightblade(6)
1:49.721 stealthed Z shadowstrike Fluffy_Pillow 81.6/100: 82% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(6)
1:50.725 stealthed Z shadowstrike Fluffy_Pillow 59.0/100: 59% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(6)
1:51.729 finish N eviscerate Fluffy_Pillow 36.3/100: 36% energy | 5.0/6: 83% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(6)
1:52.734 stealthed Z shadowstrike Fluffy_Pillow 52.6/100: 53% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5), finality_nightblade(6)
1:53.740 stealthed Z shadowstrike Fluffy_Pillow 55.0/100: 55% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5), finality_nightblade(6)
1:54.745 finish N eviscerate Fluffy_Pillow 57.3/100: 57% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5), finality_nightblade(6), recursive_strikes(2)
1:55.750 build G backstab Fluffy_Pillow 73.7/100: 74% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, finality_nightblade(6), recursive_strikes(2)
1:56.755 Waiting     0.100 sec 50.0/100: 50% energy | 1.0/6: 17% combo_points master_of_subtlety, symbols_of_death, finality_nightblade(6), recursive_strikes(4)
1:56.855 build G backstab Fluffy_Pillow 51.2/100: 51% energy | 1.0/6: 17% combo_points master_of_subtlety, symbols_of_death, finality_nightblade(6), recursive_strikes(4)
1:57.860 Waiting     2.100 sec 27.5/100: 28% energy | 3.0/6: 50% combo_points master_of_subtlety, symbols_of_death, finality_nightblade(6), recursive_strikes(6)
1:59.960 build G backstab Fluffy_Pillow 51.2/100: 51% energy | 3.0/6: 50% combo_points symbols_of_death, finality_nightblade(6), recursive_strikes(8)
2:00.966 Waiting     0.700 sec 27.6/100: 28% energy | 5.0/6: 83% combo_points symbols_of_death, finality_nightblade(6), recursive_strikes(10)
2:01.666 finish N eviscerate Fluffy_Pillow 35.5/100: 35% energy | 5.0/6: 83% combo_points symbols_of_death, finality_nightblade(6), recursive_strikes(10)
2:02.671 build G backstab Fluffy_Pillow 51.8/100: 52% energy | 0.0/6: 0% combo_points symbols_of_death, finality_eviscerate(5), finality_nightblade(6), recursive_strikes(11)
2:03.675 Waiting     0.800 sec 28.1/100: 28% energy | 1.0/6: 17% combo_points symbols_of_death, finality_eviscerate(5), finality_nightblade(6), recursive_strikes(11)
2:04.475 stealth_cds W shadow_dance Fluffy_Pillow 37.2/100: 37% energy | 1.0/6: 17% combo_points symbols_of_death, finality_eviscerate(5), finality_nightblade(6), recursive_strikes(13)
2:04.640 stealthed Z shadowstrike Fluffy_Pillow 64.0/100: 64% energy | 1.0/6: 17% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5), finality_nightblade(6), recursive_strikes(13)
2:05.646 stealthed Z shadowstrike Fluffy_Pillow 66.4/100: 66% energy | 3.0/6: 50% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5), finality_nightblade(6), recursive_strikes(14)
2:06.651 finish M nightblade Fluffy_Pillow 68.7/100: 69% energy | 5.0/6: 83% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5), finality_nightblade(6), recursive_strikes(14)
2:07.656 stealthed Z shadowstrike Fluffy_Pillow 95.1/100: 95% energy | 1.0/6: 17% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5), recursive_strikes(15)
2:08.663 stealthed X symbols_of_death Fluffy_Pillow 97.4/100: 97% energy | 3.0/6: 50% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5), recursive_strikes(15)
2:08.663 stealthed Z shadowstrike Fluffy_Pillow 62.4/100: 62% energy | 3.0/6: 50% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, death, finality_eviscerate(5), recursive_strikes(15)
2:09.669 finish N eviscerate Fluffy_Pillow 39.8/100: 40% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5)
2:10.672 build G backstab Fluffy_Pillow 56.1/100: 56% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death
2:11.677 Waiting     0.200 sec 32.5/100: 32% energy | 1.0/6: 17% combo_points master_of_subtlety, symbols_of_death
2:11.877 stealth_cds T vanish Fluffy_Pillow 34.7/100: 35% energy | 1.0/6: 17% combo_points master_of_subtlety, symbols_of_death
2:12.042 stealthed Z shadowstrike Fluffy_Pillow 61.6/100: 62% energy | 3.0/6: 50% combo_points master_of_subtlety_aura, vanish, symbols_of_death
2:13.046 finish N eviscerate Fluffy_Pillow 38.9/100: 39% energy | 5.0/6: 83% combo_points master_of_subtlety_aura, vanish, subterfuge, symbols_of_death
2:14.052 stealthed Z shadowstrike Fluffy_Pillow 55.3/100: 55% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, vanish, subterfuge, symbols_of_death, finality_eviscerate(5)
2:15.056 build G backstab Fluffy_Pillow 57.6/100: 58% energy | 3.0/6: 50% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5), recursive_strikes
2:16.059 Waiting     1.600 sec 33.9/100: 34% energy | 4.0/6: 67% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5), recursive_strikes(3)
2:17.659 build G backstab Fluffy_Pillow 52.0/100: 52% energy | 4.0/6: 67% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5), recursive_strikes(5)
2:18.664 Waiting     0.600 sec 28.3/100: 28% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5), recursive_strikes(5)
2:19.264 finish N eviscerate Fluffy_Pillow 35.1/100: 35% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5), recursive_strikes(6)
2:20.266 stealth_cds W shadow_dance Fluffy_Pillow 51.4/100: 51% energy | 1.0/6: 17% combo_points symbols_of_death, recursive_strikes(7)
2:20.266 stealthed Z shadowstrike Fluffy_Pillow 76.4/100: 76% energy | 1.0/6: 17% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, recursive_strikes(7)
2:21.269 stealthed Z shadowstrike Fluffy_Pillow 53.7/100: 54% energy | 3.0/6: 50% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, recursive_strikes(8)
2:22.273 finish N eviscerate Fluffy_Pillow 56.1/100: 56% energy | 5.0/6: 83% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, recursive_strikes(9)
2:23.279 stealthed Z shadowstrike Fluffy_Pillow 72.4/100: 72% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5), recursive_strikes(10)
2:24.285 stealthed Z shadowstrike Fluffy_Pillow 49.8/100: 50% energy | 3.0/6: 50% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5), recursive_strikes(11)
2:25.290 finish M nightblade Fluffy_Pillow 52.1/100: 52% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5), recursive_strikes(12)
2:26.294 stealth_cds U sprint Fluffy_Pillow 78.5/100: 78% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5), finality_nightblade(5), recursive_strikes(12)
2:26.294 build G backstab Fluffy_Pillow 78.5/100: 78% energy | 0.0/6: 0% combo_points master_of_subtlety, sprint, symbols_of_death, finality_eviscerate(5), finality_nightblade(5), faster_than_light_trigger, recursive_strikes(12)
2:27.297 build G backstab Fluffy_Pillow 54.8/100: 55% energy | 1.0/6: 17% combo_points master_of_subtlety, sprint, symbols_of_death, finality_eviscerate(5), finality_nightblade(5), faster_than_light_trigger, recursive_strikes(12)
2:28.302 Waiting     1.000 sec 31.1/100: 31% energy | 2.0/6: 33% combo_points master_of_subtlety, sprint, symbols_of_death, finality_eviscerate(5), finality_nightblade(5), faster_than_light_trigger, recursive_strikes(12)
2:29.302 stealthed Z shadowstrike Fluffy_Pillow 67.4/100: 67% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, vanish, subterfuge, sprint, symbols_of_death, finality_eviscerate(5), finality_nightblade(5), recursive_strikes(14)
2:30.307 stealthed Z shadowstrike Fluffy_Pillow 44.8/100: 45% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, vanish, subterfuge, sprint, symbols_of_death, finality_eviscerate(5), finality_nightblade(5), recursive_strikes(14)
2:31.311 Waiting     1.056 sec 22.1/100: 22% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, vanish, subterfuge, sprint, symbols_of_death, finality_eviscerate(5), finality_nightblade(5), recursive_strikes(15)
2:32.367 finish N eviscerate Fluffy_Pillow 59.0/100: 59% energy | 6.0/6: 100% combo_points master_of_subtlety, sprint, symbols_of_death, finality_eviscerate(5), finality_nightblade(5), recursive_strikes(15)
2:33.370 stealth_cds W shadow_dance Fluffy_Pillow 75.3/100: 75% energy | 0.0/6: 0% combo_points master_of_subtlety, sprint, symbols_of_death, finality_nightblade(5)
2:33.370 stealthed X symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, sprint, symbols_of_death, finality_nightblade(5)
2:33.370 stealthed Z shadowstrike Fluffy_Pillow 65.0/100: 65% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, sprint, symbols_of_death, death, finality_nightblade(5)
2:34.376 stealthed Z shadowstrike Fluffy_Pillow 42.4/100: 42% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(5)
2:35.380 Waiting     1.170 sec 19.7/100: 20% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(5)
2:36.550 finish M nightblade Fluffy_Pillow 32.9/100: 33% energy | 5.0/6: 83% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(5), recursive_strikes(2)
2:37.554 stealthed Z shadowstrike Fluffy_Pillow 59.2/100: 59% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, recursive_strikes(4)
2:38.558 build G backstab Fluffy_Pillow 61.6/100: 62% energy | 2.0/6: 33% combo_points master_of_subtlety, symbols_of_death, recursive_strikes(4)
2:39.563 Waiting     1.200 sec 37.9/100: 38% energy | 4.0/6: 67% combo_points master_of_subtlety, symbols_of_death, recursive_strikes(7)
2:40.763 build G backstab Fluffy_Pillow 51.5/100: 51% energy | 4.0/6: 67% combo_points master_of_subtlety, symbols_of_death, recursive_strikes(9)
2:41.767 Waiting     0.700 sec 27.8/100: 28% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death, recursive_strikes(9)
2:42.467 finish N eviscerate Fluffy_Pillow 35.7/100: 36% energy | 6.0/6: 100% combo_points master_of_subtlety, symbols_of_death, recursive_strikes(10)
2:43.470 cds L goremaws_bite Fluffy_Pillow 52.0/100: 52% energy | 0.0/6: 0% combo_points symbols_of_death, finality_eviscerate(6), recursive_strikes(10)
2:44.475 build G backstab Fluffy_Pillow 68.4/100: 68% energy | 3.0/6: 50% combo_points symbols_of_death, goremaws_bite, finality_eviscerate(6), recursive_strikes(11)
2:45.480 Waiting     0.200 sec 49.7/100: 50% energy | 4.0/6: 67% combo_points symbols_of_death, goremaws_bite, finality_eviscerate(6), recursive_strikes(13)
2:45.680 build G backstab Fluffy_Pillow 52.0/100: 52% energy | 4.0/6: 67% combo_points symbols_of_death, goremaws_bite, finality_eviscerate(6), recursive_strikes(13)
2:46.684 Waiting     0.200 sec 33.3/100: 33% energy | 5.0/6: 83% combo_points symbols_of_death, goremaws_bite, finality_eviscerate(6), recursive_strikes(13)
2:46.884 finish N eviscerate Fluffy_Pillow 35.5/100: 36% energy | 5.0/6: 83% combo_points symbols_of_death, goremaws_bite, finality_eviscerate(6), recursive_strikes(14)
2:47.887 stealth_cds W shadow_dance Fluffy_Pillow 56.9/100: 57% energy | 0.0/6: 0% combo_points symbols_of_death, goremaws_bite, recursive_strikes(14)
2:47.887 stealthed Z shadowstrike Fluffy_Pillow 81.9/100: 82% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, goremaws_bite, recursive_strikes(14)
2:48.892 stealthed Z shadowstrike Fluffy_Pillow 89.2/100: 89% energy | 3.0/6: 50% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, goremaws_bite, recursive_strikes(15)
2:49.897 finish N eviscerate Fluffy_Pillow 96.6/100: 97% energy | 5.0/6: 83% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, recursive_strikes(15)
2:50.902 stealthed X symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5), recursive_strikes(15)
2:50.902 stealthed Z shadowstrike Fluffy_Pillow 65.0/100: 65% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, death, finality_eviscerate(5), recursive_strikes(15)
2:51.908 stealthed Z shadowstrike Fluffy_Pillow 67.4/100: 67% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5), recursive_strikes(15)
2:52.911 Waiting     0.600 sec 44.7/100: 45% energy | 4.0/6: 67% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5), recursive_strikes(15)
2:53.511 build G backstab Fluffy_Pillow 51.5/100: 51% energy | 4.0/6: 67% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5), recursive_strikes(15)
2:54.517 Waiting     0.700 sec 27.8/100: 28% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5)
2:55.217 finish N eviscerate Fluffy_Pillow 35.7/100: 36% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5)
2:56.223 build G backstab Fluffy_Pillow 52.1/100: 52% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death
2:57.227 Waiting     2.100 sec 28.4/100: 28% energy | 2.0/6: 33% combo_points master_of_subtlety, symbols_of_death
2:59.327 build G backstab Fluffy_Pillow 52.1/100: 52% energy | 2.0/6: 33% combo_points symbols_of_death
3:00.331 cds K shadow_blades Fluffy_Pillow 28.4/100: 28% energy | 3.0/6: 50% combo_points symbols_of_death
3:00.331 cds H potion Fluffy_Pillow 28.4/100: 28% energy | 3.0/6: 50% combo_points symbols_of_death, shadow_blades
3:00.331 Waiting     2.000 sec 28.4/100: 28% energy | 3.0/6: 50% combo_points symbols_of_death, shadow_blades, potion_of_the_old_war
3:02.331 build G backstab Fluffy_Pillow 51.0/100: 51% energy | 4.0/6: 67% combo_points symbols_of_death, shadow_blades, potion_of_the_old_war
3:03.336 finish M nightblade Fluffy_Pillow 27.4/100: 27% energy | 6.0/6: 100% combo_points symbols_of_death, shadow_blades, potion_of_the_old_war
3:04.340 stealth_cds W shadow_dance Fluffy_Pillow 53.7/100: 54% energy | 0.0/6: 0% combo_points symbols_of_death, shadow_blades, finality_nightblade(6), potion_of_the_old_war
3:04.340 cds I use_item_ring_of_collapsing_futures Fluffy_Pillow 78.7/100: 79% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6), potion_of_the_old_war
3:04.340 cds J use_item_draught_of_souls Fluffy_Pillow 78.7/100: 79% energy | 0.0/6: 0% combo_points temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6), potion_of_the_old_war
3:07.340 stealthed X symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6), potion_of_the_old_war
3:07.340 stealthed Z shadowstrike Fluffy_Pillow 65.0/100: 65% energy | 1.0/6: 17% combo_points temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, death, finality_nightblade(6), potion_of_the_old_war
3:08.344 stealthed Z shadowstrike Fluffy_Pillow 42.3/100: 42% energy | 4.0/6: 67% combo_points temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6), potion_of_the_old_war
3:09.348 Waiting     1.372 sec 19.7/100: 20% energy | 6.0/6: 100% combo_points temptation, master_of_subtlety, symbols_of_death, shadow_blades, finality_nightblade(6), potion_of_the_old_war
3:10.720 finish N eviscerate Fluffy_Pillow 35.2/100: 35% energy | 6.0/6: 100% combo_points temptation, master_of_subtlety, symbols_of_death, shadow_blades, finality_nightblade(6), potion_of_the_old_war
3:11.722 build G backstab Fluffy_Pillow 51.5/100: 51% energy | 0.0/6: 0% combo_points temptation, master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6), potion_of_the_old_war
3:12.727 Waiting     2.100 sec 27.8/100: 28% energy | 4.0/6: 67% combo_points temptation, master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6), potion_of_the_old_war
3:14.827 build G backstab Fluffy_Pillow 51.5/100: 52% energy | 4.0/6: 67% combo_points temptation, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6), potion_of_the_old_war
3:15.832 Waiting     0.200 sec 27.9/100: 28% energy | 6.0/6: 100% combo_points temptation, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6), potion_of_the_old_war
3:16.032 finish M nightblade Fluffy_Pillow 30.1/100: 30% energy | 6.0/6: 100% combo_points temptation, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6), potion_of_the_old_war
3:17.037 stealth_cds W shadow_dance Fluffy_Pillow 96.5/100: 96% energy | 0.0/6: 0% combo_points temptation, symbols_of_death, shadow_blades, finality_eviscerate(6), potion_of_the_old_war
3:17.037 stealthed Z shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), potion_of_the_old_war
3:18.042 stealthed Z shadowstrike Fluffy_Pillow 77.3/100: 77% energy | 3.0/6: 50% combo_points temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), potion_of_the_old_war
3:19.047 finish N eviscerate Fluffy_Pillow 79.7/100: 80% energy | 6.0/6: 100% combo_points temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), potion_of_the_old_war
3:20.049 cds I use_item_ring_of_collapsing_futures Fluffy_Pillow 96.0/100: 96% energy | 0.0/6: 0% combo_points temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, potion_of_the_old_war
3:20.049 stealthed Z shadowstrike Fluffy_Pillow 96.0/100: 96% energy | 0.0/6: 0% combo_points temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, potion_of_the_old_war
3:21.052 stealthed Z shadowstrike Fluffy_Pillow 73.3/100: 73% energy | 3.0/6: 50% combo_points temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, potion_of_the_old_war
3:22.057 finish N eviscerate Fluffy_Pillow 50.7/100: 51% energy | 6.0/6: 100% combo_points temptation(2), master_of_subtlety, symbols_of_death, shadow_blades, potion_of_the_old_war
3:23.062 build G backstab Fluffy_Pillow 67.0/100: 67% energy | 0.0/6: 0% combo_points temptation(2), master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), potion_of_the_old_war
3:24.066 Waiting     0.700 sec 43.3/100: 43% energy | 3.0/6: 50% combo_points temptation(2), master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), potion_of_the_old_war
3:24.766 build G backstab Fluffy_Pillow 51.2/100: 51% energy | 3.0/6: 50% combo_points temptation(2), master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), potion_of_the_old_war
3:25.770 Waiting     0.700 sec 27.6/100: 28% energy | 5.0/6: 83% combo_points temptation(2), master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6)
3:26.470 finish N eviscerate Fluffy_Pillow 35.5/100: 35% energy | 5.0/6: 83% combo_points temptation(2), master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6)
3:27.474 stealth_cds W shadow_dance Fluffy_Pillow 51.8/100: 52% energy | 1.0/6: 17% combo_points temptation(2), symbols_of_death, shadow_blades
3:27.474 stealthed Z shadowstrike Fluffy_Pillow 76.8/100: 77% energy | 1.0/6: 17% combo_points temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades
3:28.479 stealthed Z shadowstrike Fluffy_Pillow 54.2/100: 54% energy | 4.0/6: 67% combo_points temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades
3:29.483 Waiting     0.400 sec 31.5/100: 31% energy | 6.0/6: 100% combo_points temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades
3:29.883 finish N eviscerate Fluffy_Pillow 36.0/100: 36% energy | 6.0/6: 100% combo_points temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades
3:30.886 stealthed Z shadowstrike Fluffy_Pillow 52.3/100: 52% energy | 0.0/6: 0% combo_points temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6)
3:31.890 stealthed Z shadowstrike Fluffy_Pillow 54.7/100: 55% energy | 4.0/6: 67% combo_points temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6)
3:32.893 finish N eviscerate Fluffy_Pillow 57.0/100: 57% energy | 6.0/6: 100% combo_points temptation(2), master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6)
3:33.898 build G backstab Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points temptation(2), master_of_subtlety, symbols_of_death, shadow_blades
3:34.902 build G backstab Fluffy_Pillow 76.3/100: 76% energy | 3.0/6: 50% combo_points temptation(2), master_of_subtlety, symbols_of_death, shadow_blades, recursive_strikes(2)
3:35.906 finish N eviscerate Fluffy_Pillow 52.7/100: 53% energy | 5.0/6: 83% combo_points temptation(2), master_of_subtlety, symbols_of_death, shadow_blades, recursive_strikes(2)
3:36.911 stealth_cds W shadow_dance Fluffy_Pillow 69.0/100: 69% energy | 0.0/6: 0% combo_points temptation(2), master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(5), recursive_strikes(4)
3:36.911 cds I use_item_ring_of_collapsing_futures Fluffy_Pillow 94.0/100: 94% energy | 0.0/6: 0% combo_points temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(5), recursive_strikes(4)
3:36.911 stealthed Z shadowstrike Fluffy_Pillow 94.0/100: 94% energy | 0.0/6: 0% combo_points temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(5), recursive_strikes(4)
3:37.917 stealthed Z shadowstrike Fluffy_Pillow 71.4/100: 71% energy | 3.0/6: 50% combo_points temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(5), recursive_strikes(6)
3:38.921 finish M nightblade Fluffy_Pillow 48.7/100: 49% energy | 6.0/6: 100% combo_points temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(5), recursive_strikes(6)
3:39.925 stealthed X symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(5), finality_nightblade(6), recursive_strikes(8)
3:39.925 stealthed Z shadowstrike Fluffy_Pillow 65.0/100: 65% energy | 1.0/6: 17% combo_points temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, death, finality_eviscerate(5), finality_nightblade(6), recursive_strikes(8)
3:40.929 stealthed Z shadowstrike Fluffy_Pillow 67.3/100: 67% energy | 4.0/6: 67% combo_points temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(5), finality_nightblade(6), recursive_strikes(8)
3:41.933 finish N eviscerate Fluffy_Pillow 44.7/100: 45% energy | 6.0/6: 100% combo_points temptation(3), master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(5), finality_nightblade(6), recursive_strikes(10)
3:42.938 build G backstab Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points temptation(3), master_of_subtlety, symbols_of_death, shadow_blades, finality_nightblade(6), recursive_strikes(12)
3:43.942 build G backstab Fluffy_Pillow 76.3/100: 76% energy | 3.0/6: 50% combo_points temptation(3), master_of_subtlety, symbols_of_death, shadow_blades, finality_nightblade(6), recursive_strikes(12)
3:44.947 finish N eviscerate Fluffy_Pillow 52.7/100: 53% energy | 5.0/6: 83% combo_points temptation(3), master_of_subtlety, symbols_of_death, finality_nightblade(6), recursive_strikes(14)
3:45.951 stealth_cds W shadow_dance Fluffy_Pillow 69.0/100: 69% energy | 0.0/6: 0% combo_points temptation(3), master_of_subtlety, symbols_of_death, finality_eviscerate(5), finality_nightblade(6), recursive_strikes(15)
3:45.951 stealthed Z shadowstrike Fluffy_Pillow 94.0/100: 94% energy | 0.0/6: 0% combo_points temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5), finality_nightblade(6), recursive_strikes(15)
3:46.957 stealthed Z shadowstrike Fluffy_Pillow 96.4/100: 96% energy | 2.0/6: 33% combo_points temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5), finality_nightblade(6), recursive_strikes(15)
3:47.962 finish N eviscerate Fluffy_Pillow 73.7/100: 74% energy | 5.0/6: 83% combo_points temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5), finality_nightblade(6), recursive_strikes(15)
3:48.967 stealthed Z shadowstrike Fluffy_Pillow 90.1/100: 90% energy | 0.0/6: 0% combo_points temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(6), recursive_strikes(15)
3:49.972 stealthed Z shadowstrike Fluffy_Pillow 67.4/100: 67% energy | 2.0/6: 33% combo_points temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(6)
3:50.977 finish N eviscerate Fluffy_Pillow 44.7/100: 45% energy | 5.0/6: 83% combo_points temptation(3), master_of_subtlety, symbols_of_death, finality_nightblade(6)
3:51.981 cds L goremaws_bite Fluffy_Pillow 61.1/100: 61% energy | 0.0/6: 0% combo_points temptation(3), master_of_subtlety, symbols_of_death, finality_eviscerate(5), finality_nightblade(6)
3:52.986 build G backstab Fluffy_Pillow 77.4/100: 77% energy | 3.0/6: 50% combo_points temptation(3), master_of_subtlety, symbols_of_death, goremaws_bite, finality_eviscerate(5), finality_nightblade(6)
3:53.991 build G backstab Fluffy_Pillow 58.8/100: 59% energy | 4.0/6: 67% combo_points temptation(3), master_of_subtlety, symbols_of_death, goremaws_bite, finality_eviscerate(5), finality_nightblade(6)
3:54.997 finish M nightblade Fluffy_Pillow 40.1/100: 40% energy | 5.0/6: 83% combo_points temptation(3), master_of_subtlety, symbols_of_death, goremaws_bite, finality_eviscerate(5), finality_nightblade(6)
3:56.001 stealth_cds W shadow_dance Fluffy_Pillow 71.5/100: 71% energy | 1.0/6: 17% combo_points temptation(3), symbols_of_death, goremaws_bite, finality_eviscerate(5)
3:56.001 stealthed Z shadowstrike Fluffy_Pillow 96.5/100: 96% energy | 1.0/6: 17% combo_points temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, goremaws_bite, finality_eviscerate(5)
3:57.005 stealthed Z shadowstrike Fluffy_Pillow 78.8/100: 79% energy | 3.0/6: 50% combo_points temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, goremaws_bite, finality_eviscerate(5)
3:58.009 finish N eviscerate Fluffy_Pillow 61.1/100: 61% energy | 5.0/6: 83% combo_points temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5)
3:59.014 stealthed Z shadowstrike Fluffy_Pillow 77.5/100: 77% energy | 0.0/6: 0% combo_points temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death
4:00.019 stealthed Z shadowstrike Fluffy_Pillow 79.8/100: 80% energy | 2.0/6: 33% combo_points temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death
4:01.023 build G backstab Fluffy_Pillow 57.1/100: 57% energy | 4.0/6: 67% combo_points temptation(3), master_of_subtlety, symbols_of_death
4:02.027 Waiting     0.200 sec 33.5/100: 33% energy | 5.0/6: 83% combo_points temptation(3), master_of_subtlety, symbols_of_death
4:02.227 finish N eviscerate Fluffy_Pillow 35.7/100: 36% energy | 5.0/6: 83% combo_points temptation(3), master_of_subtlety, symbols_of_death
4:03.231 build G backstab Fluffy_Pillow 52.1/100: 52% energy | 0.0/6: 0% combo_points temptation(3), master_of_subtlety, symbols_of_death, finality_eviscerate(5)
4:04.234 Waiting     2.100 sec 28.4/100: 28% energy | 1.0/6: 17% combo_points temptation(3), master_of_subtlety, symbols_of_death, finality_eviscerate(5)
4:06.334 build G backstab Fluffy_Pillow 52.1/100: 52% energy | 3.0/6: 50% combo_points temptation(3), symbols_of_death, finality_eviscerate(5)
4:07.337 Waiting     2.100 sec 28.4/100: 28% energy | 4.0/6: 67% combo_points symbols_of_death, finality_eviscerate(5)
4:09.437 build G backstab Fluffy_Pillow 52.1/100: 52% energy | 4.0/6: 67% combo_points symbols_of_death, finality_eviscerate(5)
4:10.441 Waiting     0.600 sec 28.5/100: 28% energy | 6.0/6: 100% combo_points symbols_of_death, finality_eviscerate(5)
4:11.041 finish N eviscerate Fluffy_Pillow 35.2/100: 35% energy | 6.0/6: 100% combo_points symbols_of_death, finality_eviscerate(5)
4:12.046 stealth_cds T vanish Fluffy_Pillow 51.6/100: 52% energy | 0.0/6: 0% combo_points symbols_of_death
4:12.046 stealthed Z shadowstrike Fluffy_Pillow 76.6/100: 77% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, vanish, symbols_of_death
4:13.051 stealthed Z shadowstrike Fluffy_Pillow 78.9/100: 79% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, vanish, subterfuge, symbols_of_death
4:14.055 stealthed Z shadowstrike Fluffy_Pillow 81.3/100: 81% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, vanish, subterfuge, symbols_of_death
4:15.059 finish M nightblade Fluffy_Pillow 83.6/100: 84% energy | 6.0/6: 100% combo_points master_of_subtlety, symbols_of_death
4:16.065 stealth_cds W shadow_dance Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, finality_nightblade(6)
4:16.065 stealthed X symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(6)
4:16.065 stealthed Z shadowstrike Fluffy_Pillow 65.0/100: 65% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, death, finality_nightblade(6)
4:17.069 stealthed Z shadowstrike Fluffy_Pillow 42.3/100: 42% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(6)
4:18.074 Waiting     1.371 sec 19.7/100: 20% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(6)
4:19.445 finish N eviscerate Fluffy_Pillow 35.2/100: 35% energy | 5.0/6: 83% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(6)
4:20.447 stealthed Z shadowstrike Fluffy_Pillow 51.5/100: 51% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5), finality_nightblade(6)
4:21.451 Waiting     2.000 sec 28.8/100: 29% energy | 2.0/6: 33% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5), finality_nightblade(6)
4:23.451 build G backstab Fluffy_Pillow 51.4/100: 51% energy | 2.0/6: 33% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5), finality_nightblade(6)
4:24.455 Waiting     1.600 sec 27.7/100: 28% energy | 3.0/6: 50% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5), finality_nightblade(6)
4:26.055 stealth_cds U sprint Fluffy_Pillow 45.8/100: 46% energy | 3.0/6: 50% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5), finality_nightblade(6)
4:26.294 Waiting     0.300 sec 48.5/100: 48% energy | 3.0/6: 50% combo_points sprint, symbols_of_death, finality_eviscerate(5), finality_nightblade(6), faster_than_light_trigger
4:26.594 build G backstab Fluffy_Pillow 51.9/100: 52% energy | 3.0/6: 50% combo_points sprint, symbols_of_death, finality_eviscerate(5), finality_nightblade(6), faster_than_light_trigger
4:27.597 Waiting     1.700 sec 28.2/100: 28% energy | 4.0/6: 67% combo_points sprint, symbols_of_death, finality_eviscerate(5), finality_nightblade(6), faster_than_light_trigger
4:29.297 finish M nightblade Fluffy_Pillow 72.4/100: 72% energy | 5.0/6: 83% combo_points master_of_subtlety_aura, vanish, subterfuge, sprint, symbols_of_death, finality_eviscerate(5), finality_nightblade(6)
4:30.301 stealthed X symbols_of_death Fluffy_Pillow 98.7/100: 99% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, vanish, subterfuge, sprint, symbols_of_death, finality_eviscerate(5)
4:30.301 stealthed Z shadowstrike Fluffy_Pillow 63.7/100: 64% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, vanish, subterfuge, sprint, symbols_of_death, death, finality_eviscerate(5)
4:31.306 stealthed Z shadowstrike Fluffy_Pillow 66.0/100: 66% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, vanish, subterfuge, sprint, symbols_of_death, finality_eviscerate(5)
4:32.310 build G backstab Fluffy_Pillow 93.4/100: 93% energy | 4.0/6: 67% combo_points master_of_subtlety, sprint, symbols_of_death, finality_eviscerate(5)
4:33.316 finish N eviscerate Fluffy_Pillow 69.7/100: 70% energy | 5.0/6: 83% combo_points master_of_subtlety, sprint, symbols_of_death, finality_eviscerate(5)
4:34.319 cds I use_item_ring_of_collapsing_futures Fluffy_Pillow 86.1/100: 86% energy | 2.0/6: 33% combo_points master_of_subtlety, symbols_of_death
4:34.319 cds J use_item_draught_of_souls Fluffy_Pillow 86.1/100: 86% energy | 2.0/6: 33% combo_points temptation, master_of_subtlety, symbols_of_death
4:37.319 build G backstab Fluffy_Pillow 100.0/100: 100% energy | 2.0/6: 33% combo_points temptation, symbols_of_death
4:38.325 build G backstab Fluffy_Pillow 76.4/100: 76% energy | 3.0/6: 50% combo_points temptation, symbols_of_death
4:39.330 finish N eviscerate Fluffy_Pillow 52.7/100: 53% energy | 5.0/6: 83% combo_points temptation, symbols_of_death
4:40.335 stealth_cds W shadow_dance Fluffy_Pillow 69.0/100: 69% energy | 0.0/6: 0% combo_points temptation, symbols_of_death, finality_eviscerate(5)
4:40.335 stealthed Z shadowstrike Fluffy_Pillow 94.0/100: 94% energy | 0.0/6: 0% combo_points temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5)
4:41.340 stealthed Z shadowstrike Fluffy_Pillow 96.4/100: 96% energy | 2.0/6: 33% combo_points temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5)
4:42.345 finish N eviscerate Fluffy_Pillow 73.7/100: 74% energy | 5.0/6: 83% combo_points temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5)
4:43.350 stealthed Z shadowstrike Fluffy_Pillow 90.1/100: 90% energy | 0.0/6: 0% combo_points temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death
4:44.355 stealthed Z shadowstrike Fluffy_Pillow 67.4/100: 67% energy | 2.0/6: 33% combo_points temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death
4:45.361 finish N eviscerate Fluffy_Pillow 44.8/100: 45% energy | 6.0/6: 100% combo_points temptation, master_of_subtlety, symbols_of_death
4:46.365 stealth_cds W shadow_dance Fluffy_Pillow 61.1/100: 61% energy | 0.0/6: 0% combo_points temptation, master_of_subtlety, symbols_of_death, finality_eviscerate(6)
4:46.365 stealthed Z shadowstrike Fluffy_Pillow 86.1/100: 86% energy | 0.0/6: 0% combo_points temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6)
4:47.370 stealthed Z shadowstrike Fluffy_Pillow 63.5/100: 63% energy | 2.0/6: 33% combo_points temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6)
4:48.375 stealthed Z shadowstrike Fluffy_Pillow 40.8/100: 41% energy | 4.0/6: 67% combo_points temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6)
4:49.378 cds I use_item_ring_of_collapsing_futures Fluffy_Pillow 18.1/100: 18% energy | 6.0/6: 100% combo_points temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6)
4:49.378 Waiting     1.509 sec 18.1/100: 18% energy | 6.0/6: 100% combo_points temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6)
4:50.887 finish N eviscerate Fluffy_Pillow 35.2/100: 35% energy | 6.0/6: 100% combo_points temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6)
4:51.893 cds L goremaws_bite Fluffy_Pillow 51.5/100: 52% energy | 0.0/6: 0% combo_points temptation(2), master_of_subtlety, symbols_of_death
4:52.987 build G backstab Fluffy_Pillow 68.9/100: 69% energy | 3.0/6: 50% combo_points temptation(2), master_of_subtlety, symbols_of_death, goremaws_bite

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 8806 8481 0
Agility 30616 28910 18504 (10748)
Stamina 48391 48391 28183
Intellect 5325 5000 0
Spirit 0 0 0
Health 2903460 2903460 0
Energy 100 100 0
Combo Points 6 6 0
Crit 23.64% 23.64% 5456
Haste 12.88% 12.88% 4831
Damage / Heal Versatility 9.03% 8.23% 3909
Attack Power 30616 28910 0
Mastery 80.81% 80.81% 8510
Armor 2297 2297 2297
Run Speed 8 0 0

Gear

Source Slot Average Item Level: 891.00
Local Head Cowl of Fright
ilevel: 885, stats: { 300 Armor, +2829 Sta, +1886 AgiInt, +1015 Mastery, +547 Crit, +1076 unknown }
Local Neck Sea Fan Pendant
ilevel: 880, stats: { +1519 Sta, +1633 Vers, +965 Mastery }, enchant: mark_of_the_hidden_satyr
Local Shoulders Steelgazer Hide Mantle
ilevel: 880, stats: { 273 Armor, +1351 AgiInt, +2027 Sta, +673 Haste, +476 Vers, +771 unknown }
Local Shirt Common Gray Shirt
ilevel: 1
Local Chest Biornskin Vest
ilevel: 890, stats: { 376 Armor, +1977 AgiInt, +2965 Sta, +1034 Crit, +557 Mastery }
Local Waist Strand of Whelk Shells
ilevel: 880, stats: { 205 Armor, +2026 Sta, +1351 AgiInt, +673 Haste, +476 Mastery }, gems: { +150 Mastery }
Local Legs Legwraps of Unworthy Souls
ilevel: 880, stats: { 318 Armor, +2701 Sta, +1801 AgiInt, +964 Mastery, +570 Haste }
Local Feet Shadow Satyr's Walk
ilevel: 910, stats: { 276 Armor, +2680 Sta, +1786 Agi, +827 Haste, +459 Mastery }
Local Wrists Denial of the Half-Giants
ilevel: 910, stats: { 176 Armor, +2010 Sta, +1340 Agi, +276 Crit, +689 Mastery }
Local Hands Cruel Vice Grips
ilevel: 885, stats: { 231 Armor, +2122 Sta, +1415 AgiInt, +686 Crit, +485 Mastery }
Local Finger1 Grubby Silver Ring
ilevel: 880, stats: { +1519 Sta, +1484 Crit, +1114 Vers }, gems: { +150 Vers }, enchant: { +200 Mastery }
Local Finger2 Ring of Collapsing Futures
ilevel: 870, stats: { +1385 Sta, +1677 Mastery, +768 Haste, +419 Avoidance }, enchant: { +200 Vers }
Local Trinket1 Nightblooming Frond
ilevel: 910, stats: { +2264 Agi }
Local Trinket2 Draught of Souls
ilevel: 910, stats: { +1225 Haste }
Local Back Drape of the Mana-Starved
ilevel: 875, stats: { 142 Armor, +1450 Sta, +967 StrAgiInt, +586 Crit, +259 Vers }, gems: { +200 Agi }, enchant: { +200 Agi }
Local Main Hand Fangs of the Devourer
ilevel: 906, weapon: { 3844 - 7140, 1.8 }, stats: { +983 Agi, +1475 Sta, +368 Crit, +353 Mastery }, relics: { +53 ilevels, +51 ilevels, +52 ilevels }
Local Off Hand Fangs of the Devourer
ilevel: 906, weapon: { 3844 - 7140, 1.8 }, stats: { +983 Agi, +1475 Sta, +368 Crit, +353 Mastery }

Talents

Level
15 Master of Subtlety (Subtlety Rogue) Weaponmaster (Subtlety Rogue) Gloomblade (Subtlety Rogue)
30 Nightstalker Subterfuge Shadow Focus
45 Deeper Stratagem Anticipation Vigor
60 Soothing Darkness (Subtlety Rogue) Elusiveness Cheat Death
75 Strike from the Shadows (Subtlety Rogue) Prey on the Weak Tangled Shadow (Subtlety Rogue)
90 Premeditation (Subtlety Rogue) Alacrity Enveloping Shadows (Subtlety Rogue)
100 Master of Shadows (Subtlety Rogue) Marked for Death Death from Above

Profile

rogue="NF+DoS"
origin="https://eu.api.battle.net/wow/character/dalaran/Esdeåth/advanced"
level=110
race=human
role=attack
position=back
professions=alchemy=800/enchanting=133
talents=1210011
artifact=17:0:0:0:0:851:1:852:3:853:3:854:3:855:3:856:3:857:3:858:3:859:3:860:3:861:1:862:1:863:1:864:1:865:1:866:1:1349:1:1386:14
spec=subtlety

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,name=flask_of_the_seventh_demon
actions.precombat+=/augmentation,name=defiled
actions.precombat+=/food,name=seedbattered_fish_plate
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/stealth
actions.precombat+=/potion,name=old_war
actions.precombat+=/marked_for_death,if=raid_event.adds.in>40
# Defined variables that doesn't change during the fight
actions.precombat+=/variable,name=ssw_refund,value=equipped.shadow_satyrs_walk*(4+ssw_refund_offset)
actions.precombat+=/variable,name=stealth_threshold,value=(15+talent.vigor.enabled*35+talent.master_of_shadows.enabled*30+variable.ssw_refund)
actions.precombat+=/enveloping_shadows,if=combo_points>=5
actions.precombat+=/symbols_of_death

# Executed every time the actor is available.
actions=call_action_list,name=cds
# Fully switch to the Stealthed Rotation (by doing so, it forces pooling if nothing is available)
actions+=/run_action_list,name=stealthed,if=stealthed.all
actions+=/call_action_list,name=finish,if=combo_points>=5|(combo_points>=4&spell_targets.shuriken_storm>=3&spell_targets.shuriken_storm<=4)
actions+=/call_action_list,name=stealth_als,if=combo_points.deficit>=2+talent.premeditation.enabled
actions+=/call_action_list,name=build,if=energy.deficit<=variable.stealth_threshold

# Builders
actions.build=shuriken_storm,if=spell_targets.shuriken_storm>=2
actions.build+=/gloomblade
actions.build+=/backstab

# Cooldowns
actions.cds=potion,name=old_war,if=buff.bloodlust.react|target.time_to_die<=25|buff.shadow_blades.up
actions.cds+=/use_item,slot=finger2,if=(buff.shadow_blades.up&stealthed.rogue)|target.time_to_die<20
actions.cds+=/use_item,slot=trinket2,if=(buff.shadow_blades.up&stealthed.rogue)|target.time_to_die<20
actions.cds+=/blood_fury,if=stealthed.rogue
actions.cds+=/berserking,if=stealthed.rogue
actions.cds+=/arcane_torrent,if=stealthed.rogue&energy.deficit>70
actions.cds+=/shadow_blades,if=combo_points<=2|(equipped.denial_of_the_halfgiants&combo_points>=1)
actions.cds+=/goremaws_bite,if=!stealthed.all&cooldown.shadow_dance.charges_fractional<=2.45&((combo_points.deficit>=4-(time<10)*2&energy.deficit>50+talent.vigor.enabled*25-(time>=10)*15)|target.time_to_die<8)
actions.cds+=/marked_for_death,target_if=min:target.time_to_die,if=target.time_to_die<combo_points.deficit|(raid_event.adds.in>40&combo_points.deficit>=4+talent.deeper_strategem.enabled+talent.anticipation.enabled)

# Finishers
actions.finish=enveloping_shadows,if=buff.enveloping_shadows.remains<target.time_to_die&buff.enveloping_shadows.remains<=combo_points*1.8
actions.finish+=/death_from_above,if=spell_targets.death_from_above>=6
actions.finish+=/nightblade,cycle_targets=1,if=target.time_to_die>8&((refreshable&(!finality|buff.finality_nightblade.up))|remains<tick_time)
actions.finish+=/death_from_above
actions.finish+=/eviscerate

# Stealth Action List Starter
actions.stealth_als=call_action_list,name=stealth_cds,if=energy.deficit<=variable.stealth_threshold&(!equipped.shadow_satyrs_walk|cooldown.shadow_dance.charges_fractional>=2.45|energy.deficit>=10)
actions.stealth_als+=/call_action_list,name=stealth_cds,if=spell_targets.shuriken_storm>=5
actions.stealth_als+=/call_action_list,name=stealth_cds,if=(cooldown.shadowmeld.up&!cooldown.vanish.up&cooldown.shadow_dance.charges<=1)
actions.stealth_als+=/call_action_list,name=stealth_cds,if=target.time_to_die<12*cooldown.shadow_dance.charges_fractional*(1+equipped.shadow_satyrs_walk*0.5)

# Stealth Cooldowns
actions.stealth_cds=shadow_dance,if=charges_fractional>=2.45
actions.stealth_cds+=/vanish
actions.stealth_cds+=/sprint_offensive
actions.stealth_cds+=/shadow_dance,if=charges>=2&combo_points<=1
actions.stealth_cds+=/pool_resource,for_next=1,extra_amount=40
actions.stealth_cds+=/shadowmeld,if=energy>=40&energy.deficit>=10+variable.ssw_refund
actions.stealth_cds+=/shadow_dance,if=combo_points<=1

# Stealthed Rotation
actions.stealthed=symbols_of_death,if=(buff.symbols_of_death.remains<target.time_to_die-4&buff.symbols_of_death.remains<=buff.symbols_of_death.duration*0.3)|equipped.shadow_satyrs_walk&energy.time_to_max<0.25
actions.stealthed+=/call_action_list,name=finish,if=combo_points>=5
actions.stealthed+=/shuriken_storm,if=buff.shadowmeld.down&((combo_points.deficit>=3&spell_targets.shuriken_storm>=2+talent.premeditation.enabled+equipped.shadow_satyrs_walk)|buff.the_dreadlords_deceit.stack>=29)
actions.stealthed+=/shadowstrike

head=cowl_of_fright,id=139205,bonus_id=1805/43/1507/3337
neck=sea_fan_pendant,id=142428,bonus_id=3507/1497,enchant=mark_of_the_hidden_satyr
shoulders=steelgazer_hide_mantle,id=134154,bonus_id=3417/43/1542/3337
back=drape_of_the_manastarved,id=141543,bonus_id=1808/1487/3337,gems=200agi,enchant=200agi
chest=biornskin_vest,id=134197,bonus_id=3417/1552/3337
shirt=common_gray_shirt,id=3428
wrists=denial_of_the_halfgiants,id=137100,bonus_id=3459/3458
hands=cruel_vice_grips,id=133617,bonus_id=3510/1537/3337
waist=strand_of_whelk_shells,id=142416,bonus_id=3507/1808/1497,gems=150mastery
legs=legwraps_of_unworthy_souls,id=133616,bonus_id=3418/1532/3337
feet=shadow_satyrs_walk,id=137032,bonus_id=3459/3458
finger1=grubby_silver_ring,id=139236,bonus_id=1806/1808/1502,gems=150vers,enchant=200mastery
finger2=ring_of_collapsing_futures,id=142173,bonus_id=40/3453/1482/3336,enchant=200vers
trinket1=nightblooming_frond,id=140802,bonus_id=3519
trinket2=draught_of_souls,id=140808,bonus_id=3519
main_hand=fangs_of_the_devourer,id=128476,bonus_id=743,gem_id=139267/142512/139253/0,relic_id=1806:1507:3336/3468:1492/1806:1502/0
off_hand=fangs_of_the_devourer,id=128479

# Gear Summary
# gear_ilvl=891.06
# gear_agility=18504
# gear_stamina=28183
# gear_crit_rating=5349
# gear_haste_rating=4736
# gear_mastery_rating=8343
# gear_versatility_rating=3832
# gear_avoidance_rating=419
# gear_armor=2297

NF+EEF : 601418 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
601418.3 601418.3 817.1 / 0.136% 113849.0 / 18.9% 20635.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
29.0 29.0 Energy 22.57% 56.8 100.0% 100%
Origin https://eu.api.battle.net/wow/character/dalaran/Esdeåth/advanced
Talents
  • 15: Master of Subtlety (Subtlety Rogue)
  • 30: Subterfuge
  • 45: Deeper Stratagem
  • 90: Premeditation (Subtlety Rogue)
  • 100: Master of Shadows (Subtlety Rogue)
  • Talent Calculator
Artifact
Professions
  • alchemy: 800
  • enchanting: 133

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
NF+EEF 601418
auto_attack_mh 10447 1.8% 120.5 2.03sec 26356 16735 Direct 120.5 24990 49977 26357 24.5% 19.1%  

Stats details: auto_attack_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 120.54 120.54 0.00 0.00 1.5749 0.0000 3176932.16 4670391.21 31.98 16734.88 16734.88
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 68.02 56.43% 24990.01 19317 25498 24996.83 24431 25463 1699809 2498880 31.98
crit 29.56 24.52% 49977.25 38633 50996 49992.38 47712 50996 1477123 2171511 31.98
miss 22.96 19.05% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_mh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
auto_attack_oh 5185 0.9% 119.6 2.04sec 13183 8307 Direct 119.6 12494 24990 13183 24.6% 19.0%  

Stats details: auto_attack_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 119.61 119.61 0.00 0.00 1.5870 0.0000 1576898.32 2318189.90 31.98 8307.03 8307.03
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 67.47 56.41% 12494.07 9658 12749 12497.60 12150 12723 843024 1239325 31.98
crit 29.37 24.55% 24990.29 19317 25498 24997.66 23787 25498 733875 1078865 31.98
miss 22.77 19.04% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_oh

Static Values
  • id:1
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Backstab 29098 4.9% 51.4 5.60sec 171243 170478 Direct 51.4 137399 274854 171247 24.6% 0.0%  

Stats details: backstab

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 51.38 51.38 0.00 0.00 1.0045 0.0000 8799050.65 12935437.92 31.98 170477.98 170477.98
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 38.73 75.38% 137399.33 106732 140886 137440.73 132347 140886 5321796 7823544 31.98
crit 12.65 24.62% 274853.91 213463 281772 274934.98 259261 281772 3477255 5111894 31.98
 
 

Action details: backstab

Static Values
  • id:53
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:53
  • name:Backstab
  • school:physical
  • tooltip:
  • description:Stab the target, causing ${$sw2*$<mult>} Physical damage. Damage increased by {$s4=30}% when you are behind your target. |cFFFFFFFFAwards {$s3=1} combo $lpoint:points;.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.70
 
Collapse 1620 0.3% 5.8 43.15sec 82678 0 Direct 5.8 66480 132965 82668 24.4% 0.0%  

Stats details: collapse

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.82 5.82 0.00 0.00 0.0000 0.0000 481180.94 481180.94 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.40 75.64% 66480.13 50574 66758 66001.57 0 66758 292652 292652 0.00
crit 1.42 24.36% 132965.17 101148 133516 100214.06 0 133516 188529 188529 0.00
 
 

Action details: collapse

Static Values
  • id:234142
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:15.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:234142
  • name:Collapse
  • school:shadow
  • tooltip:
  • description:Deal {$s1=40000} Shadow damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:40000.00
  • base_dd_max:40000.00
 
Eviscerate 176917 29.4% 53.7 5.56sec 987417 983011 Direct 53.7 706953 1415166 987436 39.6% 0.0%  

Stats details: eviscerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 53.70 53.70 0.00 0.00 1.0045 0.0000 53019678.81 77943950.01 31.98 983010.95 983010.95
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 32.43 60.40% 706953.42 432169 1008351 707324.92 649781 792755 22926822 33704600 31.98
crit 21.26 39.60% 1415166.06 864338 2016703 1416261.75 1225147 1604784 30092857 44239350 31.98
 
 

Action details: eviscerate

Static Values
  • id:196819
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.15
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:196819
  • name:Eviscerate
  • school:physical
  • tooltip:
  • description:Finishing move that disembowels the target, causing damage per combo point. 1 point : ${$m1*1} damage 2 points: ${$m1*2} damage 3 points: ${$m1*3} damage 4 points: ${$m1*4} damage 5 points: ${$m1*5} damage{$?s193531=false}[ 6 points: ${$m1*6} damage][]
Weapon
  • normalized:false
  • weapon_power_mod:0.000000
  • weapon_multiplier:0.00
 
Goremaw's Bite 0 (10051) 0.0% (1.7%) 4.7 63.50sec 649683 646787

Stats details: goremaws_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.66 0.00 0.00 0.00 1.0045 0.0000 0.00 0.00 0.00 646786.71 646786.71
 
 

Action details: goremaws_bite

Static Values
  • id:209782
  • school:shadow
  • resource:none
  • range:8.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!stealthed.all&cooldown.shadow_dance.charges_fractional<=2.45&((combo_points.deficit>=4-(time<10)*2&energy.deficit>50+talent.vigor.enabled*25-(time>=10)*15)|target.time_to_die<8)
Spelldata
  • id:209782
  • name:Goremaw's Bite
  • school:physical
  • tooltip:
  • description:Lashes out at the target, inflicting ${$209783sw2+$209784sw2} Shadow damage and reducing movement speed by {$209786s1=60}% for {$209786d=8 seconds}. Grants $220901o2 Energy over {$220901d=6 seconds}. |cFFFFFFFFAwards {$220901s1=3} combo $lpoint:points;.|r
 
    Goremaw's Bite (_mh) 6701 1.1% 4.7 63.50sec 433000 0 Direct 4.7 348346 696716 432962 24.3% 0.0%  

Stats details: goremaws_bite_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.66 4.66 0.00 0.00 0.0000 0.0000 2017836.01 2017836.01 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 3.53 75.70% 348346.19 272066 359127 347942.61 0 359127 1228852 1228852 0.00
crit 1.13 24.30% 696715.70 544132 718254 506263.63 0 718254 788984 788984 0.00
 
 

Action details: goremaws_bite_mh

Static Values
  • id:209783
  • school:shadow
  • resource:none
  • range:8.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:209783
  • name:Goremaw's Bite
  • school:shadow
  • tooltip:
  • description:{$@spelldesc209782=Lashes out at the target, inflicting ${$209783sw2+$209784sw2} Shadow damage and reducing movement speed by {$209786s1=60}% for {$209786d=8 seconds}. Grants $220901o2 Energy over {$220901d=6 seconds}. |cFFFFFFFFAwards {$220901s1=3} combo $lpoint:points;.|r}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:10.00
 
    Goremaw's Bite (_oh) 3349 0.6% 4.7 63.50sec 216683 0 Direct 4.7 174227 348089 216680 24.4% 0.0%  

Stats details: goremaws_bite_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.66 4.66 0.00 0.00 0.0000 0.0000 1009772.58 1009772.58 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 3.52 75.58% 174227.29 136039 179572 173786.99 0 179572 613647 613647 0.00
crit 1.14 24.42% 348088.60 272079 359144 251567.09 0 359144 396126 396126 0.00
 
 

Action details: goremaws_bite_oh

Static Values
  • id:209784
  • school:shadow
  • resource:none
  • range:8.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:209784
  • name:Goremaw's Bite
  • school:shadow
  • tooltip:
  • description:{$@spelldesc209782=Lashes out at the target, inflicting ${$209783sw2+$209784sw2} Shadow damage and reducing movement speed by {$209786s1=60}% for {$209786d=8 seconds}. Grants $220901o2 Energy over {$220901d=6 seconds}. |cFFFFFFFFAwards {$220901s1=3} combo $lpoint:points;.|r}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:10.00
 
Mark of the Hidden Satyr 8884 1.5% 16.5 18.14sec 162516 0 Direct 16.5 130454 260794 162516 24.6% 0.0%  

Stats details: mark_of_the_hidden_satyr

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.46 16.46 0.00 0.00 0.0000 0.0000 2674444.83 2674444.83 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 12.41 75.40% 130453.65 100276 132364 130473.94 122738 132364 1618702 1618702 0.00
crit 4.05 24.60% 260793.88 200552 264729 256804.37 0 264729 1055743 1055743 0.00
 
 

Action details: mark_of_the_hidden_satyr

Static Values
  • id:191259
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191259
  • name:Mark of the Hidden Satyr
  • school:fire
  • tooltip:
  • description:Deals fire damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:2.500000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Nightblade 122144 20.4% 17.1 17.51sec 2153834 2144270 Periodic 144.7 204099 408150 254220 24.6% 0.0% 96.1%

Stats details: nightblade

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.08 0.00 144.71 144.71 1.0045 2.0000 36789237.72 36789237.72 0.00 119998.04 2144269.84
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 109.2 75.44% 204098.85 137013 266408 204145.14 196445 220588 22280362 22280362 0.00
crit 35.5 24.56% 408150.05 274025 532816 408307.16 378817 456525 14508875 14508875 0.00
 
 

Action details: nightblade

Static Values
  • id:195452
  • school:shadow
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:25.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:target.time_to_die>8&((refreshable&(!finality|buff.finality_nightblade.up))|remains<tick_time)
Spelldata
  • id:195452
  • name:Nightblade
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec and snared by attacks.
  • description:Finishing move that infects the target with shadowy energy, dealing Shadow damage over time and causing attacks against the target to reduce movement speed by {$206760s1=30}% for {$206760d=8 seconds}. Lasts longer per combo point. 1 point : ${$m1*8/2} over 8 sec 2 points: ${$m1*10/2} over 10 sec 3 points: ${$m1*12/2} over 12 sec 4 points: ${$m1*14/2} over 14 sec 5 points: ${$m1*16/2} over 16 sec{$?s193531=false}[ 6 points: ${$m1*18/2} over 18 sec][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:1.380000
  • spell_power_mod.tick:0.000000
  • base_td:1.00
  • dot_duration:6.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Potion of the Old War 18784 3.1% 23.3 8.16sec 238742 0 Direct 23.3 191601 383245 238740 24.6% 0.0%  

Stats details: potion_of_the_old_war

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.27 23.27 0.00 0.00 0.0000 0.0000 5554442.11 8165556.03 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.54 75.40% 191601.09 146122 192882 191591.38 182862 192882 3361194 4941274 31.98
crit 5.72 24.60% 383244.52 292245 385763 382432.59 0 385763 2193248 3224282 31.91
 
 

Action details: potion_of_the_old_war

Static Values
  • id:188028
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188028
  • name:Potion of the Old War
  • school:physical
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:135920.00
  • base_dd_max:203880.00
 
Recursive Strikes 40422 6.7% 81.4 4.67sec 149237 0 Direct 81.4 119629 240096 149237 24.6% 0.0%  

Stats details: recursive_strikes

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 81.41 81.41 0.00 0.00 0.0000 0.0000 12149841.30 17861417.57 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 61.40 75.42% 119628.86 24772 174395 118366.70 76298 150000 7345211 10798155 31.98
crit 20.01 24.58% 240095.93 49544 348790 237633.34 99088 348790 4804631 7063262 31.98
 
 

Action details: recursive_strikes

Static Values
  • id:225739
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:225739
  • name:Recursive Strikes
  • school:physical
  • tooltip:
  • description:{$@spelldesc225135=Your attacks have a chance to grant Recursive Strikes for {$225736d=15 seconds}, causing your auto attacks to deal an additional {$225736s1=3602} damage and increase the intensity of Recursive Strikes.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:9601.48
  • base_dd_max:9601.48
 
Shadow Blades 0 (15829) 0.0% (2.6%) 2.1 180.15sec 2234607 0

Stats details: shadow_blades

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.10 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: shadow_blades

Static Values
  • id:121471
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:combo_points<=2|(equipped.denial_of_the_halfgiants&combo_points>=1)
Spelldata
  • id:121471
  • name:Shadow Blades
  • school:physical
  • tooltip:Autoattacks deal pure Shadow damage. Combo-point-generating attacks generate {$s2=1} additional combo point.
  • description:Draws upon surrounding shadows to empower your weapons, causing auto attacks to deal Shadow damage and abilities that generate combo points to generate 1 additional combo point. Lasts {$d=15 seconds}.
 
    Shadow Blade (_mh) 10555 1.7% 67.3 3.54sec 46378 32291 Direct 67.3 37208 74419 46378 24.6% 0.0%  

Stats details: shadow_blade_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 67.33 67.33 0.00 0.00 1.4363 0.0000 3122638.82 3122638.82 0.00 32290.69 32290.69
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 50.74 75.36% 37208.50 28397 37484 37206.32 36428 37484 1887893 1887893 0.00
crit 16.59 24.64% 74418.72 56794 74969 74412.49 71823 74969 1234746 1234746 0.00
 
 

Action details: shadow_blade_mh

Static Values
  • id:121473
  • school:shadow
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:121473
  • name:Shadow Blade
  • school:shadow
  • tooltip:
  • description:Strike with dark energy, dealing Shadow damage equal to {$s1=1}% weapon damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
    Shadow Blade Off-hand 5274 0.9% 67.3 3.54sec 23173 16134 Direct 67.3 18605 37202 23173 24.6% 0.0%  

Stats details: shadow_blade_offhand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 67.33 67.33 0.00 0.00 1.4363 0.0000 1560246.58 1560246.58 0.00 16134.25 16134.25
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 50.79 75.44% 18605.45 14199 18742 18604.43 18255 18742 945019 945019 0.00
crit 16.54 24.56% 37201.98 28397 37484 37200.41 35726 37484 615227 615227 0.00
 
 

Action details: shadow_blade_offhand

Static Values
  • id:121474
  • school:shadow
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:121474
  • name:Shadow Blade Off-hand
  • school:shadow
  • tooltip:
  • description:Strike with dark energy, dealing Shadow damage equal to {$s1=1}% weapon damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Shadow Nova 11078 1.8% 32.3 9.51sec 102800 0 Direct 32.3 82589 165180 102801 24.5% 0.0%  

Stats details: shadow_nova

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 32.35 32.35 0.00 0.00 0.0000 0.0000 3325243.01 3325243.01 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 24.43 75.53% 82589.44 68830 82595 82589.56 81831 82595 2017750 2017750 0.00
crit 7.92 24.47% 165179.69 137659 165191 165080.49 0 165191 1307493 1307493 0.00
 
 

Action details: shadow_nova

Static Values
  • id:197800
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:5.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:197800
  • name:Shadow Nova
  • school:shadow
  • tooltip:
  • description:Deals {$s1=0} Shadow damage to enemies with $A1 yards.
 
Shadowstrike 122450 (150960) 20.3% (25.1%) 105.3 2.86sec 429862 427941 Direct 105.3 260248 520516 348667 34.0% 0.0%  

Stats details: shadowstrike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 105.33 105.33 0.00 0.00 1.0045 0.0000 36723363.87 53986823.42 31.98 427940.66 427940.66
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 69.55 66.03% 260248.04 216893 260271 260248.65 257681 260271 18099133 26607440 31.98
crit 35.78 33.97% 520515.55 433785 520542 520516.77 515853 520542 18624231 27379384 31.98
 
 

Action details: shadowstrike

Static Values
  • id:185438
  • school:physical
  • resource:energy
  • range:15.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:185438
  • name:Shadowstrike
  • school:physical
  • tooltip:
  • description:Strike through the shadows, $?a231718[appearing behind your target and ][]dealing $sw2 Physical damage. |cFFFFFFFFAwards {$s3=1} combo $lpoint:points;.|r
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:8.50
 
    Soul Rip 28510 4.7% 104.7 2.85sec 81657 0 Direct 104.7 65553 131106 81656 24.6% 0.0%  

Stats details: soul_rip

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 104.74 104.74 0.00 0.00 0.0000 0.0000 8552330.08 8552330.08 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 79.01 75.43% 65553.23 65553 65553 65553.23 65553 65553 5179151 5179151 0.00
crit 25.73 24.57% 131106.47 131106 131106 131106.47 131106 131106 3373179 3373179 0.00
 
 

Action details: soul_rip

Static Values
  • id:220893
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:220893
  • name:Soul Rip
  • school:shadow
  • tooltip:
  • description:{$@spelldesc209835=After using Shadowstrike or Cheap Shot, Akaari's Soul appears $m1 sec later and Soul Rips your target, dealing {$220893s1=1} Shadow damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:1.500000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Simple Action Stats Execute Interval
NF+EEF
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:NF+EEF
  • harmful:false
  • if_expr:
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:NF+EEF
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:NF+EEF
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Shadow Dance 26.4 11.44sec

Stats details: shadow_dance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 26.38 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: shadow_dance

Static Values
  • id:185313
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:charges_fractional>=2.45
Spelldata
  • id:185313
  • name:Shadow Dance
  • school:physical
  • tooltip:
  • description:Allows use of all Stealth abilities and grants all the combat benefits of Stealth for {$d=3 seconds}. Effect not broken from taking damage or attacking. {$?s14062=false}[Movement speed while active is increased by {$1784s3=0}% and damage dealt is increased by {$1784s4=0}%. ]?s108209[Abilities cost {$112942s1=75}% less while active. ][]{$?s31223=false}[Attacks from Shadow Dance and for {$31223s1=5} sec after deal {$31665s1=10}% more damage. ][]
 
Sprint 2.7 122.29sec

Stats details: sprint

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.74 0.00 86.83 0.00 0.0000 0.2500 0.00 0.00 0.00 0.00 0.00
 
 

Action details: sprint

Static Values
  • id:2983
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:2983
  • name:Sprint
  • school:physical
  • tooltip:Movement speed increased by $w1%.
  • description:Increases your movement speed by {$s1=70}% for {$d=8 seconds}. Usable while stealthed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:0.25
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Symbols of Death 13.3 23.75sec

Stats details: symbols_of_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.32 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: symbols_of_death

Static Values
  • id:212283
  • school:physical
  • resource:energy
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:10.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:212283
  • name:Symbols of Death
  • school:physical
  • tooltip:All damage done increased by {$s1=20}%.
  • description:Invoke ancient symbols of power, increasing all damage you deal by {$s1=20}% for {$d=35 seconds}, and causing your next Shadowstrike to critically strike. Unaffected by the global cooldown.
 
Vanish 2.8 122.26sec

Stats details: vanish

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.85 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: vanish

Static Values
  • id:1856
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:1856
  • name:Vanish
  • school:physical
  • tooltip:Improved stealth.
  • description:Allows you to vanish from sight, entering stealth while in combat. For the first {$11327d=3 seconds} after vanishing, damage and harmful effects received will not break stealth. Also breaks movement impairing effects.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Arcane Enchant 1.2 0.1 105.7sec 86.3sec 8.28% 8.28% 0.1(0.1) 1.2

Buff details

  • buff initial source:NF+EEF
  • cooldown name:buff_arcane_enchant
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:4828.95

Stack Uptimes

  • arcane_enchant_1:8.28%

Trigger Attempt Success

  • trigger_pct:74.89%

Spelldata details

  • id:225730
  • name:Arcane Enchant
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc225129=Your melee and ranged attacks have a chance to grant you a Fiery, Frost, or Arcane enchant for {$225726d=20 seconds}. }
  • max_stacks:0
  • duration:20.00
  • cooldown:1.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 26.08% 0.0(0.0) 1.0

Buff details

  • buff initial source:NF+EEF
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Death 13.3 0.0 22.7sec 23.8sec 1.55% 12.46% 0.0(0.0) 0.2

Buff details

  • buff initial source:NF+EEF
  • cooldown name:buff_death
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • death_1:1.55%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:227151
  • name:Death
  • tooltip:Your next Shadowstrike will critically strike.
  • description:{$@spelldesc212283=Invoke ancient symbols of power, increasing all damage you deal by {$s1=20}% for {$d=35 seconds}, and causing your next Shadowstrike to critically strike. Unaffected by the global cooldown.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Faster Than Light Trigger 2.7 0.0 122.3sec 122.3sec 2.73% 2.73% 0.0(0.0) 2.7

Buff details

  • buff initial source:NF+EEF
  • cooldown name:buff_faster_than_light_trigger
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • faster_than_light_trigger_1:2.73%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:197270
  • name:Faster Than Light Trigger
  • tooltip:
  • description:
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
Fiery Enchant 1.2 0.1 106.0sec 89.1sec 7.96% 7.96% 0.1(0.1) 1.1

Buff details

  • buff initial source:NF+EEF
  • cooldown name:buff_fiery_enchant
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:4828.95

Stack Uptimes

  • fiery_enchant_1:7.96%

Trigger Attempt Success

  • trigger_pct:73.49%

Spelldata details

  • id:225726
  • name:Fiery Enchant
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc225129=Your melee and ranged attacks have a chance to grant you a Fiery, Frost, or Arcane enchant for {$225726d=20 seconds}. }
  • max_stacks:0
  • duration:20.00
  • cooldown:1.00
  • default_chance:0.00%
Finality: Eviscerate 27.1 0.0 11.1sec 11.1sec 49.06% 49.53% 0.0(0.0) 0.0

Buff details

  • buff initial source:NF+EEF
  • cooldown name:buff_finality_eviscerate
  • max_stacks:10
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.04

Stack Uptimes

  • finality_eviscerate_5:22.53%
  • finality_eviscerate_6:26.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:197496
  • name:Finality: Eviscerate
  • tooltip:Your next Eviscerate will do $w1% increased damage.
  • description:
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Finality: Nightblade 8.7 0.0 35.2sec 35.2sec 42.91% 41.02% 0.0(0.0) 0.0

Buff details

  • buff initial source:NF+EEF
  • cooldown name:buff_finality_nightblade
  • max_stacks:6
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.04

Stack Uptimes

  • finality_nightblade_5:17.69%
  • finality_nightblade_6:25.22%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:197498
  • name:Finality: Nightblade
  • tooltip:Your next Nightblade will do $w1% increased damage.
  • description:
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Frost Enchant 1.2 0.1 106.0sec 87.7sec 8.26% 8.26% 0.1(0.1) 1.2

Buff details

  • buff initial source:NF+EEF
  • cooldown name:buff_frost_enchant
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:4828.95

Stack Uptimes

  • frost_enchant_1:8.26%

Trigger Attempt Success

  • trigger_pct:75.20%

Spelldata details

  • id:225729
  • name:Frost Enchant
  • tooltip:Mastery increased by $w1.
  • description:{$@spelldesc225129=Your melee and ranged attacks have a chance to grant you a Fiery, Frost, or Arcane enchant for {$225726d=20 seconds}. }
  • max_stacks:0
  • duration:20.00
  • cooldown:1.00
  • default_chance:0.00%
Goremaw's Bite 4.7 0.0 63.5sec 63.5sec 9.17% 9.17% 27.6(27.6) 4.6

Buff details

  • buff initial source:NF+EEF
  • cooldown name:buff_goremaws_bite
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • goremaws_bite_1:9.17%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:220901
  • name:Goremaw's Bite
  • tooltip:Generating {$s2=5} Energy every $t2 sec.
  • description:{$@spelldesc209782=Lashes out at the target, inflicting ${$209783sw2+$209784sw2} Shadow damage and reducing movement speed by {$209786s1=60}% for {$209786d=8 seconds}. Grants $220901o2 Energy over {$220901d=6 seconds}. |cFFFFFFFFAwards {$220901s1=3} combo $lpoint:points;.|r}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Master of Subtlety 37.1 1.4 8.2sec 7.9sec 34.66% 47.64% 1.4(1.4) 12.7

Buff details

  • buff initial source:NF+EEF
  • cooldown name:buff_master_of_subtlety
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • master_of_subtlety_1:34.66%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:31223
  • name:Master of Subtlety
  • tooltip:
  • description:Attacks made while stealthed and for {$s1=5} seconds after breaking stealth cause an additional {$31665s1=10}% damage.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Master of Subtlety (_aura) 37.1 1.4 8.2sec 8.0sec 48.71% 34.43% 1.4(1.4) 0.0

Buff details

  • buff initial source:NF+EEF
  • cooldown name:buff_master_of_subtlety_aura
  • max_stacks:1
  • duration:150.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • master_of_subtlety_aura_1:48.71%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:31223
  • name:Master of Subtlety
  • tooltip:
  • description:Attacks made while stealthed and for {$s1=5} seconds after breaking stealth cause an additional {$31665s1=10}% damage.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of the Old War 2.0 0.0 150.6sec 0.0sec 16.24% 16.24% 0.0(0.0) 2.0

Buff details

  • buff initial source:NF+EEF
  • cooldown name:buff_potion_of_the_old_war
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_the_old_war_1:16.24%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188028
  • name:Potion of the Old War
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Recursive Strikes 4.5 82.6 61.0sec 2.6sec 24.51% 100.00% 22.4(22.4) 4.2

Buff details

  • buff initial source:NF+EEF
  • cooldown name:buff_recursive_strikes
  • max_stacks:15
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • recursive_strikes_1:0.88%
  • recursive_strikes_2:1.16%
  • recursive_strikes_3:1.50%
  • recursive_strikes_4:1.20%
  • recursive_strikes_5:1.47%
  • recursive_strikes_6:1.20%
  • recursive_strikes_7:1.45%
  • recursive_strikes_8:1.20%
  • recursive_strikes_9:1.42%
  • recursive_strikes_10:1.22%
  • recursive_strikes_11:1.39%
  • recursive_strikes_12:1.19%
  • recursive_strikes_13:1.34%
  • recursive_strikes_14:1.07%
  • recursive_strikes_15:6.82%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225736
  • name:Recursive Strikes
  • tooltip:Your auto attacks deal an additional $w1 damage and increase the potency of this effect.
  • description:{$@spelldesc225135=Your attacks have a chance to grant Recursive Strikes for {$225736d=15 seconds}, causing your auto attacks to deal an additional {$225736s1=3602} damage and increase the intensity of Recursive Strikes.}
  • max_stacks:15
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Shadow Blades 2.1 0.0 180.2sec 180.2sec 34.74% 39.81% 0.0(0.0) 2.0

Buff details

  • buff initial source:NF+EEF
  • cooldown name:buff_shadow_blades
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • shadow_blades_1:34.74%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:121471
  • name:Shadow Blades
  • tooltip:Autoattacks deal pure Shadow damage. Combo-point-generating attacks generate {$s2=1} additional combo point.
  • description:Draws upon surrounding shadows to empower your weapons, causing auto attacks to deal Shadow damage and abilities that generate combo points to generate 1 additional combo point. Lasts {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Shadow Dance 26.4 0.0 11.5sec 11.5sec 43.65% 43.65% 0.0(0.0) 26.0

Buff details

  • buff initial source:NF+EEF
  • cooldown name:buff_shadow_dance
  • max_stacks:1
  • duration:5.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • shadow_dance_1:43.65%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:185313
  • name:Shadow Dance
  • tooltip:
  • description:Allows use of all Stealth abilities and grants all the combat benefits of Stealth for {$d=3 seconds}. Effect not broken from taking damage or attacking. {$?s14062=false}[Movement speed while active is increased by {$1784s3=0}% and damage dealt is increased by {$1784s4=0}%. ]?s108209[Abilities cost {$112942s1=75}% less while active. ][]{$?s31223=false}[Attacks from Shadow Dance and for {$31223s1=5} sec after deal {$31665s1=10}% more damage. ][]
  • max_stacks:0
  • duration:3.00
  • cooldown:1.00
  • default_chance:0.00%
Sprint 2.7 0.0 122.3sec 122.3sec 7.21% 7.21% 86.8(86.8) 2.7

Buff details

  • buff initial source:NF+EEF
  • cooldown name:buff_sprint
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • sprint_1:7.21%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2983
  • name:Sprint
  • tooltip:Movement speed increased by $w1%.
  • description:Increases your movement speed by {$s1=70}% for {$d=8 seconds}. Usable while stealthed.
  • max_stacks:0
  • duration:8.00
  • cooldown:120.00
  • default_chance:0.00%
Stealth 6.5 0.0 45.0sec 52.1sec 1.03% 1.03% 0.0(0.0) 0.0

Buff details

  • buff initial source:NF+EEF
  • cooldown name:buff_stealth
  • max_stacks:1
  • duration:150.00
  • cooldown:2.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stealth_1:1.03%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:1784
  • name:Stealth
  • tooltip:Stealthed.$?$w3!=0[ Movement speed increased by $w3%.][]$?$w4!=0[ Damage increased by $w4%.][]
  • description:Conceals you in the shadows until cancelled, allowing you to stalk enemies without being seen. {$?s14062=false}[Movement speed while stealthed is increased by {$s3=0}% and damage dealt is increased by {$s4=0}%.]?s108209[ Abilities cost {$112942s1=75}% less while stealthed. ][]{$?s31223=false}[ Attacks from Stealth and for {$31223s1=5} sec after deal {$31665s1=10}% more damage.][]
  • max_stacks:0
  • duration:-0.00
  • cooldown:2.00
  • default_chance:100.00%
Subterfuge 6.6 0.0 44.6sec 52.2sec 6.55% 6.55% 0.0(0.0) 6.5

Buff details

  • buff initial source:NF+EEF
  • cooldown name:buff_subterfuge
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • subterfuge_1:6.55%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:115192
  • name:Subterfuge
  • tooltip:Temporarily concealed in the shadows.
  • description:{$@spelldesc108208=Your abilities requiring Stealth can still be used for {$115192d=3 seconds} after Stealth breaks.$?c3[ Also increases the duration of Shadow Dance by ${$m2/1000} sec.][ Also causes Garrote to deal {$115192s2=125}% increased damage and have no cooldown when used from Stealth or {$115192d=3 seconds} after Stealth breaks.]}
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
Symbols of Death 1.2 12.1 188.4sec 23.8sec 99.80% 99.29% 12.1(12.1) 0.2

Buff details

  • buff initial source:NF+EEF
  • cooldown name:buff_symbols_of_death
  • max_stacks:1
  • duration:35.00
  • cooldown:10.00
  • default_chance:100.00%
  • default_value:1.20

Stack Uptimes

  • symbols_of_death_1:99.80%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:212283
  • name:Symbols of Death
  • tooltip:All damage done increased by {$s1=20}%.
  • description:Invoke ancient symbols of power, increasing all damage you deal by {$s1=20}% for {$d=35 seconds}, and causing your next Shadowstrike to critically strike. Unaffected by the global cooldown.
  • max_stacks:0
  • duration:35.00
  • cooldown:10.00
  • default_chance:0.00%
Temptation 1.9 4.0 177.6sec 43.4sec 36.66% 66.97% 0.0(0.0) 1.4

Buff details

  • buff initial source:NF+EEF
  • cooldown name:buff_temptation
  • max_stacks:10
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • temptation_1:9.64%
  • temptation_2:9.71%
  • temptation_3:9.33%
  • temptation_4:7.79%
  • temptation_5:0.20%
  • temptation_6:0.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:234143
  • name:Temptation
  • tooltip:Increased chance for your Ring of Collapsing Futures to incur a {$s1=5} min cooldown.
  • description:{$@spelldesc234142=Deal {$s1=40000} Shadow damage to an enemy.}
  • max_stacks:10
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Vanish 5.6 0.0 52.0sec 52.0sec 5.54% 5.54% 0.0(0.0) 5.5

Buff details

  • buff initial source:NF+EEF
  • cooldown name:buff_vanish
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • vanish_1:5.54%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:11327
  • name:Vanish
  • tooltip:Improved stealth.$?$w3!=0[ Movement speed increased by $w3%.][]$?$w4!=0[ Damage increased by $w4%.][]
  • description:
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:NF+EEF
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Seventh Demon

Buff details

  • buff initial source:NF+EEF
  • cooldown name:buff_flask_of_the_seventh_demon
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:1300.00

Stack Uptimes

  • flask_of_the_seventh_demon_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188033
  • name:Flask of the Seventh Demon
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (seedbattered_fish_plate)

Buff details

  • buff initial source:NF+EEF
  • cooldown name:buff_seedbattered_fish_plate
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:versatility_rating
  • amount:375.00

Stack Uptimes

  • seedbattered_fish_plate_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225605
  • name:Well Fed
  • tooltip:Versatility increased by $w1.
  • description:Increases versatility by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
NF+EEF
backstab Energy 51.4 1798.3 35.0 35.0 4892.9
eviscerate Energy 53.7 1879.3 35.0 35.0 28212.4
eviscerate Combo Points 53.7 299.1 5.6 5.6 177272.0
nightblade Energy 17.1 427.0 25.0 25.0 86152.7
nightblade Combo Points 17.1 95.2 5.6 5.6 386413.7
shadowstrike Energy 105.3 4213.1 40.0 40.0 10746.4
symbols_of_death Energy 13.3 431.1 32.4 32.4 0.0
Resource Gains Type Count Total Average Overflow
backstab Combo Points 51.38 51.38 (12.94%) 1.00 0.00 0.00%
goremaws_bite Combo Points 4.66 13.82 (3.48%) 2.97 0.16 1.12%
shadowstrike Combo Points 105.33 210.65 (53.05%) 2.00 0.00 0.00%
energy_regen Energy 1179.34 3370.63 (38.79%) 2.86 94.53 2.73%
Shadow Techniques Combo Points 72.73 71.91 (18.11%) 0.99 15.37 17.61%
Master of Shadows Energy 37.49 789.13 (9.08%) 21.05 148.07 15.80%
Shadow Blades Combo Points 59.08 49.33 (12.42%) 0.83 9.75 16.50%
Energetic Stabbing Energy 26.29 657.35 (7.57%) 25.00 0.00 0.00%
Goremaw's Bite Energy 27.59 134.92 (1.55%) 4.89 3.04 2.20%
Relentless Strikes Energy 70.78 3105.14 (35.74%) 43.87 50.15 1.59%
Shadow Satyr's Walk Energy 105.33 631.96 (7.27%) 6.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Energy 28.84 29.04
Combo Points 1.32 1.31
Combat End Resource Mean Min Max
Energy 40.41 6.64 100.00
Combo Points 2.77 0.00 6.00

Benefits & Uptimes

Benefits %
Uptimes %
Energy Cap 1.5%

Statistics & Data Analysis

Fight Length
Sample Data NF+EEF Fight Length
Count 4999
Mean 301.28
Minimum 222.03
Maximum 381.32
Spread ( max - min ) 159.29
Range [ ( max - min ) / 2 * 100% ] 26.44%
DPS
Sample Data NF+EEF Damage Per Second
Count 4999
Mean 601418.34
Minimum 525990.38
Maximum 736964.48
Spread ( max - min ) 210974.10
Range [ ( max - min ) / 2 * 100% ] 17.54%
Standard Deviation 29474.5108
5th Percentile 554900.63
95th Percentile 652437.05
( 95th Percentile - 5th Percentile ) 97536.42
Mean Distribution
Standard Deviation 416.8742
95.00% Confidence Intervall ( 600601.28 - 602235.40 )
Normalized 95.00% Confidence Intervall ( 99.86% - 100.14% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 93
0.1% Error 9227
0.1 Scale Factor Error with Delta=300 7416123
0.05 Scale Factor Error with Delta=300 29664490
0.01 Scale Factor Error with Delta=300 741612226
Priority Target DPS
Sample Data NF+EEF Priority Target Damage Per Second
Count 4999
Mean 601418.34
Minimum 525990.38
Maximum 736964.48
Spread ( max - min ) 210974.10
Range [ ( max - min ) / 2 * 100% ] 17.54%
Standard Deviation 29474.5108
5th Percentile 554900.63
95th Percentile 652437.05
( 95th Percentile - 5th Percentile ) 97536.42
Mean Distribution
Standard Deviation 416.8742
95.00% Confidence Intervall ( 600601.28 - 602235.40 )
Normalized 95.00% Confidence Intervall ( 99.86% - 100.14% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 93
0.1% Error 9227
0.1 Scale Factor Error with Delta=300 7416123
0.05 Scale Factor Error with Delta=300 29664490
0.01 Scale Factor Error with Delta=300 741612226
DPS(e)
Sample Data NF+EEF Damage Per Second (Effective)
Count 4999
Mean 601418.34
Minimum 525990.38
Maximum 736964.48
Spread ( max - min ) 210974.10
Range [ ( max - min ) / 2 * 100% ] 17.54%
Damage
Sample Data NF+EEF Damage
Count 4999
Mean 180533137.78
Minimum 132032482.63
Maximum 233645193.25
Spread ( max - min ) 101612710.62
Range [ ( max - min ) / 2 * 100% ] 28.14%
DTPS
Sample Data NF+EEF Damage Taken Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data NF+EEF Healing Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data NF+EEF Healing Per Second (Effective)
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data NF+EEF Heal
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data NF+EEF Healing Taken Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data NF+EEF Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data NF+EEFTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data NF+EEF Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,name=flask_of_the_seventh_demon
1 0.00 augmentation,name=defiled
2 0.00 food,name=seedbattered_fish_plate
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 stealth
5 0.00 potion,name=old_war
6 0.00 marked_for_death,if=raid_event.adds.in>40
7 0.00 variable,name=ssw_refund,value=equipped.shadow_satyrs_walk*(4+ssw_refund_offset)
Defined variables that doesn't change during the fight
8 0.00 variable,name=stealth_threshold,value=(15+talent.vigor.enabled*35+talent.master_of_shadows.enabled*30+variable.ssw_refund)
9 0.00 enveloping_shadows,if=combo_points>=5
A 0.00 symbols_of_death
Default action list Executed every time the actor is available.
# count action,conditions
B 0.00 call_action_list,name=cds
C 0.00 run_action_list,name=stealthed,if=stealthed.all
Fully switch to the Stealthed Rotation (by doing so, it forces pooling if nothing is available)
D 0.00 call_action_list,name=finish,if=combo_points>=5|(combo_points>=4&spell_targets.shuriken_storm>=3&spell_targets.shuriken_storm<=4)
E 0.00 call_action_list,name=stealth_als,if=combo_points.deficit>=2+talent.premeditation.enabled
F 0.00 call_action_list,name=build,if=energy.deficit<=variable.stealth_threshold
actions.build Builders
# count action,conditions
0.00 shuriken_storm,if=spell_targets.shuriken_storm>=2
0.00 gloomblade
G 51.38 backstab
actions.cds Cooldowns
# count action,conditions
H 1.00 potion,name=old_war,if=buff.bloodlust.react|target.time_to_die<=25|buff.shadow_blades.up
I 5.82 use_item,slot=finger2,if=(buff.shadow_blades.up&stealthed.rogue)|target.time_to_die<20
0.00 blood_fury,if=stealthed.rogue
0.00 berserking,if=stealthed.rogue
0.00 arcane_torrent,if=stealthed.rogue&energy.deficit>70
J 2.10 shadow_blades,if=combo_points<=2|(equipped.denial_of_the_halfgiants&combo_points>=1)
K 4.66 goremaws_bite,if=!stealthed.all&cooldown.shadow_dance.charges_fractional<=2.45&((combo_points.deficit>=4-(time<10)*2&energy.deficit>50+talent.vigor.enabled*25-(time>=10)*15)|target.time_to_die<8)
0.00 marked_for_death,target_if=min:target.time_to_die,if=target.time_to_die<combo_points.deficit|(raid_event.adds.in>40&combo_points.deficit>=4+talent.deeper_strategem.enabled+talent.anticipation.enabled)
actions.finish Finishers
# count action,conditions
0.00 enveloping_shadows,if=buff.enveloping_shadows.remains<target.time_to_die&buff.enveloping_shadows.remains<=combo_points*1.8
0.00 death_from_above,if=spell_targets.death_from_above>=6
L 17.08 nightblade,cycle_targets=1,if=target.time_to_die>8&((refreshable&(!finality|buff.finality_nightblade.up))|remains<tick_time)
0.00 death_from_above
M 53.69 eviscerate
actions.stealth_cds Stealth Cooldowns
# count action,conditions
R 3.69 shadow_dance,if=charges_fractional>=2.45
S 2.85 vanish
T 2.74 sprint_offensive
U 4.53 shadow_dance,if=charges>=2&combo_points<=1
0.00 pool_resource,for_next=1,extra_amount=40
0.00 shadowmeld,if=energy>=40&energy.deficit>=10+variable.ssw_refund
V 18.16 shadow_dance,if=combo_points<=1
actions.stealthed Stealthed Rotation
# count action,conditions
W 12.32 symbols_of_death,if=(buff.symbols_of_death.remains<target.time_to_die-4&buff.symbols_of_death.remains<=buff.symbols_of_death.duration*0.3)|equipped.shadow_satyrs_walk&energy.time_to_max<0.25
X 0.00 call_action_list,name=finish,if=combo_points>=5
0.00 shuriken_storm,if=buff.shadowmeld.down&((combo_points.deficit>=3&spell_targets.shuriken_storm>=2+talent.premeditation.enabled+equipped.shadow_satyrs_walk)|buff.the_dreadlords_deceit.stack>=29)
Y 105.33 shadowstrike

Sample Sequence

0124578AJIYYLRYYMYMGGMRWYYMIYYLSYYMRWYYMYMTUYYMYIYMGGMUWYYLYYMKGMUYIYMWYYLUYYMYYMUYYMYYGMVYYYLVWYYMYGGMGGLVYYYMYGMVYYYLYGMKGGMVWYYLYGMGGGMVYYMYSYLWYTGGYMYGGMVYYYLVYYMYYMGGGGMKJHLVWYYMYYMVYYMWYYLGGMVYYMWYYMGGMVYYMYYLGGMVYYMYGLGGGMKGGMVWYYMYGLVWYYMYGSYLWYTGGYMYGGMVYYMYYMVYYMY

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask NF+EEF 100.0/100: 100% energy | 0.0/6: 0% combo_points
Pre precombat 1 augmentation NF+EEF 100.0/100: 100% energy | 0.0/6: 0% combo_points
Pre precombat 2 food NF+EEF 100.0/100: 100% energy | 0.0/6: 0% combo_points
Pre precombat 4 stealth Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, stealth
Pre precombat 5 potion Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, stealth, potion_of_the_old_war
Pre precombat 7 ssw_refund Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, stealth, potion_of_the_old_war
Pre precombat 8 stealth_threshold Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, stealth, potion_of_the_old_war
Pre precombat A symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, stealth, symbols_of_death, death, potion_of_the_old_war
0:00.000 cds J shadow_blades Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, stealth, symbols_of_death, death, potion_of_the_old_war
0:00.000 cds I use_item_ring_of_collapsing_futures Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, stealth, symbols_of_death, shadow_blades, death, potion_of_the_old_war
0:00.000 stealthed Y shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points temptation, master_of_subtlety_aura, stealth, symbols_of_death, shadow_blades, death, potion_of_the_old_war
0:01.005 stealthed Y shadowstrike Fluffy_Pillow 80.3/100: 80% energy | 3.0/6: 50% combo_points bloodlust, temptation, master_of_subtlety_aura, stealth, subterfuge, symbols_of_death, shadow_blades, recursive_strikes, potion_of_the_old_war
0:02.008 finish L nightblade Fluffy_Pillow 60.6/100: 61% energy | 6.0/6: 100% combo_points bloodlust, temptation, master_of_subtlety_aura, stealth, subterfuge, symbols_of_death, shadow_blades, recursive_strikes(3), potion_of_the_old_war
0:03.013 stealth_cds R shadow_dance Fluffy_Pillow 89.9/100: 90% energy | 1.0/6: 17% combo_points bloodlust, temptation, master_of_subtlety, symbols_of_death, shadow_blades, finality_nightblade(6), recursive_strikes(5), potion_of_the_old_war
0:03.013 stealthed Y shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points bloodlust, temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6), recursive_strikes(5), potion_of_the_old_war
0:04.018 stealthed Y shadowstrike Fluffy_Pillow 80.3/100: 80% energy | 4.0/6: 67% combo_points bloodlust, temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6), recursive_strikes(5), potion_of_the_old_war
0:05.023 finish M eviscerate Fluffy_Pillow 60.6/100: 61% energy | 6.0/6: 100% combo_points bloodlust, temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6), recursive_strikes(7), potion_of_the_old_war
0:06.028 stealthed Y shadowstrike Fluffy_Pillow 79.9/100: 80% energy | 2.0/6: 33% combo_points bloodlust, temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6), recursive_strikes(9), potion_of_the_old_war
0:07.033 finish M eviscerate Fluffy_Pillow 85.3/100: 85% energy | 5.0/6: 83% combo_points bloodlust, temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6), recursive_strikes(11), potion_of_the_old_war
0:08.039 build G backstab Fluffy_Pillow 100.0/100: 100% energy | 2.0/6: 33% combo_points bloodlust, temptation, master_of_subtlety, symbols_of_death, shadow_blades, finality_nightblade(6), recursive_strikes(14), potion_of_the_old_war
0:09.044 build G backstab Fluffy_Pillow 79.3/100: 79% energy | 4.0/6: 67% combo_points bloodlust, temptation, master_of_subtlety, symbols_of_death, shadow_blades, finality_nightblade(6), recursive_strikes(14), potion_of_the_old_war
0:10.049 finish M eviscerate Fluffy_Pillow 58.6/100: 59% energy | 6.0/6: 100% combo_points bloodlust, temptation, master_of_subtlety, symbols_of_death, shadow_blades, finality_nightblade(6), recursive_strikes(15), potion_of_the_old_war
0:11.055 stealth_cds R shadow_dance Fluffy_Pillow 78.0/100: 78% energy | 1.0/6: 17% combo_points bloodlust, temptation, master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6), recursive_strikes(15), potion_of_the_old_war
0:11.055 stealthed W symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points bloodlust, temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6), recursive_strikes(15), potion_of_the_old_war
0:11.055 stealthed Y shadowstrike Fluffy_Pillow 65.0/100: 65% energy | 1.0/6: 17% combo_points bloodlust, temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, death, finality_eviscerate(6), finality_nightblade(6), recursive_strikes(15), potion_of_the_old_war
0:12.060 stealthed Y shadowstrike Fluffy_Pillow 45.3/100: 45% energy | 4.0/6: 67% combo_points bloodlust, temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6), recursive_strikes(15), potion_of_the_old_war
0:13.064 Waiting     0.700 sec 25.6/100: 26% energy | 6.0/6: 100% combo_points bloodlust, temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6), recursive_strikes(15), potion_of_the_old_war
0:13.764 finish M eviscerate Fluffy_Pillow 35.6/100: 36% energy | 6.0/6: 100% combo_points bloodlust, temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6), recursive_strikes(15), potion_of_the_old_war
0:14.768 cds I use_item_ring_of_collapsing_futures Fluffy_Pillow 94.9/100: 95% energy | 0.0/6: 0% combo_points bloodlust, temptation, master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6), recursive_strikes(15), potion_of_the_old_war
0:15.000 stealthed Y shadowstrike Fluffy_Pillow 98.2/100: 98% energy | 0.0/6: 0% combo_points bloodlust, temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6), recursive_strikes(15), potion_of_the_old_war
0:16.005 stealthed Y shadowstrike Fluffy_Pillow 78.5/100: 78% energy | 3.0/6: 50% combo_points bloodlust, temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6), recursive_strikes(15), potion_of_the_old_war
0:17.009 finish L nightblade Fluffy_Pillow 58.8/100: 59% energy | 6.0/6: 100% combo_points bloodlust, temptation(2), master_of_subtlety, symbols_of_death, shadow_blades, finality_nightblade(6), recursive_strikes(15), potion_of_the_old_war
0:18.013 stealth_cds S vanish Fluffy_Pillow 88.1/100: 88% energy | 0.0/6: 0% combo_points bloodlust, temptation(2), master_of_subtlety, symbols_of_death, shadow_blades, recursive_strikes(15), potion_of_the_old_war
0:18.013 stealthed Y shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points bloodlust, temptation(2), master_of_subtlety_aura, vanish, symbols_of_death, shadow_blades, recursive_strikes(15), potion_of_the_old_war
0:19.018 stealthed Y shadowstrike Fluffy_Pillow 80.3/100: 80% energy | 3.0/6: 50% combo_points bloodlust, temptation(2), master_of_subtlety_aura, vanish, subterfuge, symbols_of_death, shadow_blades, recursive_strikes(15), potion_of_the_old_war
0:20.024 finish M eviscerate Fluffy_Pillow 60.6/100: 61% energy | 6.0/6: 100% combo_points bloodlust, temptation(2), master_of_subtlety_aura, vanish, subterfuge, symbols_of_death, shadow_blades, recursive_strikes(15), potion_of_the_old_war
0:21.029 stealth_cds R shadow_dance Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points bloodlust, temptation(2), master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), recursive_strikes(15), potion_of_the_old_war
0:21.029 stealthed W symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points bloodlust, temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), recursive_strikes(15), potion_of_the_old_war
0:21.055 stealthed Y shadowstrike Fluffy_Pillow 65.0/100: 65% energy | 0.0/6: 0% combo_points bloodlust, temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, death, finality_eviscerate(6), recursive_strikes(15), potion_of_the_old_war
0:22.058 stealthed Y shadowstrike Fluffy_Pillow 70.3/100: 70% energy | 4.0/6: 67% combo_points bloodlust, temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), recursive_strikes(15), potion_of_the_old_war
0:23.063 finish M eviscerate Fluffy_Pillow 50.6/100: 51% energy | 6.0/6: 100% combo_points bloodlust, temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6)
0:24.068 stealthed Y shadowstrike Fluffy_Pillow 69.9/100: 70% energy | 0.0/6: 0% combo_points bloodlust, temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades
0:25.072 finish M eviscerate Fluffy_Pillow 50.2/100: 50% energy | 5.0/6: 83% combo_points bloodlust, temptation(2), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades
0:26.076 stealth_cds T sprint Fluffy_Pillow 69.5/100: 70% energy | 0.0/6: 0% combo_points bloodlust, temptation(2), master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(5)
0:26.076 stealth_cds U shadow_dance Fluffy_Pillow 69.5/100: 70% energy | 0.0/6: 0% combo_points bloodlust, temptation(2), master_of_subtlety, sprint, symbols_of_death, shadow_blades, finality_eviscerate(5), faster_than_light_trigger
0:26.076 stealthed Y shadowstrike Fluffy_Pillow 94.5/100: 95% energy | 0.0/6: 0% combo_points bloodlust, temptation(2), master_of_subtlety_aura, shadow_dance, sprint, symbols_of_death, shadow_blades, finality_eviscerate(5), faster_than_light_trigger
0:27.080 stealthed Y shadowstrike Fluffy_Pillow 74.8/100: 75% energy | 3.0/6: 50% combo_points bloodlust, temptation(2), master_of_subtlety_aura, shadow_dance, sprint, symbols_of_death, shadow_blades, finality_eviscerate(5), faster_than_light_trigger
0:28.084 finish M eviscerate Fluffy_Pillow 80.1/100: 80% energy | 6.0/6: 100% combo_points bloodlust, temptation(2), master_of_subtlety_aura, shadow_dance, sprint, symbols_of_death, shadow_blades, finality_eviscerate(5), faster_than_light_trigger
0:29.089 stealthed Y shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points bloodlust, temptation(2), master_of_subtlety_aura, shadow_dance, vanish, subterfuge, sprint, symbols_of_death, shadow_blades
0:30.094 cds I use_item_ring_of_collapsing_futures Fluffy_Pillow 80.3/100: 80% energy | 3.0/6: 50% combo_points bloodlust, temptation(2), master_of_subtlety_aura, shadow_dance, vanish, subterfuge, sprint, symbols_of_death, shadow_blades
0:30.094 stealthed Y shadowstrike Fluffy_Pillow 80.3/100: 80% energy | 3.0/6: 50% combo_points bloodlust, temptation(3), master_of_subtlety_aura, shadow_dance, vanish, subterfuge, sprint, symbols_of_death, shadow_blades
0:31.098 finish M eviscerate Fluffy_Pillow 85.6/100: 86% energy | 6.0/6: 100% combo_points bloodlust, temptation(3), master_of_subtlety, vanish, subterfuge, sprint, symbols_of_death, shadow_blades
0:32.103 build G backstab Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points bloodlust, temptation(3), master_of_subtlety, sprint, symbols_of_death, shadow_blades, finality_eviscerate(6)
0:33.108 build G backstab Fluffy_Pillow 79.3/100: 79% energy | 3.0/6: 50% combo_points bloodlust, temptation(3), master_of_subtlety, sprint, symbols_of_death, shadow_blades, finality_eviscerate(6)
0:34.112 finish M eviscerate Fluffy_Pillow 58.6/100: 59% energy | 5.0/6: 83% combo_points bloodlust, temptation(3), master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6)
0:35.116 stealth_cds U shadow_dance Fluffy_Pillow 77.9/100: 78% energy | 0.0/6: 0% combo_points bloodlust, temptation(3), master_of_subtlety, symbols_of_death, shadow_blades
0:35.116 stealthed W symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points bloodlust, temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades
0:35.116 stealthed Y shadowstrike Fluffy_Pillow 65.0/100: 65% energy | 0.0/6: 0% combo_points bloodlust, temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, death
0:36.120 stealthed Y shadowstrike Fluffy_Pillow 45.3/100: 45% energy | 4.0/6: 67% combo_points bloodlust, temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades
0:37.126 finish L nightblade Fluffy_Pillow 25.6/100: 26% energy | 6.0/6: 100% combo_points bloodlust, temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades
0:38.130 stealthed Y shadowstrike Fluffy_Pillow 54.9/100: 55% energy | 0.0/6: 0% combo_points bloodlust, temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6)
0:39.135 stealthed Y shadowstrike Fluffy_Pillow 60.2/100: 60% energy | 3.0/6: 50% combo_points bloodlust, temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6)
0:40.140 finish M eviscerate Fluffy_Pillow 40.5/100: 41% energy | 6.0/6: 100% combo_points bloodlust, temptation(3), master_of_subtlety, symbols_of_death, shadow_blades, finality_nightblade(6)
0:41.145 cds K goremaws_bite Fluffy_Pillow 57.6/100: 58% energy | 0.0/6: 0% combo_points temptation(3), master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6)
0:42.149 build G backstab Fluffy_Pillow 73.6/100: 74% energy | 4.0/6: 67% combo_points temptation(3), master_of_subtlety, symbols_of_death, shadow_blades, goremaws_bite, finality_eviscerate(6), finality_nightblade(6)
0:43.153 finish M eviscerate Fluffy_Pillow 54.6/100: 55% energy | 6.0/6: 100% combo_points temptation(3), master_of_subtlety, symbols_of_death, shadow_blades, goremaws_bite, finality_eviscerate(6), finality_nightblade(6)
0:44.157 stealth_cds U shadow_dance Fluffy_Pillow 75.6/100: 76% energy | 0.0/6: 0% combo_points temptation(3), master_of_subtlety, symbols_of_death, shadow_blades, goremaws_bite, finality_nightblade(6)
0:44.157 stealthed Y shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, goremaws_bite, finality_nightblade(6)
0:45.161 cds I use_item_ring_of_collapsing_futures Fluffy_Pillow 82.0/100: 82% energy | 3.0/6: 50% combo_points temptation(3), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, goremaws_bite, finality_nightblade(6)
0:45.161 stealthed Y shadowstrike Fluffy_Pillow 82.0/100: 82% energy | 3.0/6: 50% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, goremaws_bite, finality_nightblade(6)
0:46.164 finish M eviscerate Fluffy_Pillow 89.0/100: 89% energy | 6.0/6: 100% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, goremaws_bite, finality_nightblade(6)
0:47.168 stealthed W symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6)
0:47.168 stealthed Y shadowstrike Fluffy_Pillow 65.0/100: 65% energy | 0.0/6: 0% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, death, finality_eviscerate(6), finality_nightblade(6)
0:48.172 stealthed Y shadowstrike Fluffy_Pillow 42.0/100: 42% energy | 3.0/6: 50% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6)
0:49.176 Waiting     1.447 sec 19.0/100: 19% energy | 6.0/6: 100% combo_points temptation(4), master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6)
0:50.623 finish L nightblade Fluffy_Pillow 34.8/100: 35% energy | 6.0/6: 100% combo_points temptation(4), master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6)
0:51.626 stealth_cds U shadow_dance Fluffy_Pillow 60.8/100: 61% energy | 0.0/6: 0% combo_points temptation(4), master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6)
0:51.626 stealthed Y shadowstrike Fluffy_Pillow 85.8/100: 86% energy | 0.0/6: 0% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6)
0:52.631 stealthed Y shadowstrike Fluffy_Pillow 62.8/100: 63% energy | 3.0/6: 50% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6)
0:53.636 finish M eviscerate Fluffy_Pillow 39.9/100: 40% energy | 6.0/6: 100% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6)
0:54.641 stealthed Y shadowstrike Fluffy_Pillow 55.9/100: 56% energy | 0.0/6: 0% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades
0:55.645 Waiting     0.700 sec 32.9/100: 33% energy | 3.0/6: 50% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades
0:56.345 stealthed Y shadowstrike Fluffy_Pillow 40.5/100: 41% energy | 3.0/6: 50% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades
0:57.349 Waiting     1.681 sec 17.5/100: 18% energy | 6.0/6: 100% combo_points temptation(4), master_of_subtlety, symbols_of_death
0:59.030 finish M eviscerate Fluffy_Pillow 35.9/100: 36% energy | 6.0/6: 100% combo_points temptation(4), master_of_subtlety, symbols_of_death
1:00.034 stealth_cds U shadow_dance Fluffy_Pillow 51.9/100: 52% energy | 0.0/6: 0% combo_points temptation(4), master_of_subtlety, symbols_of_death, finality_eviscerate(6)
1:00.034 stealthed Y shadowstrike Fluffy_Pillow 76.9/100: 77% energy | 0.0/6: 0% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6)
1:01.039 stealthed Y shadowstrike Fluffy_Pillow 54.0/100: 54% energy | 2.0/6: 33% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6)
1:02.046 Waiting     0.400 sec 31.0/100: 31% energy | 5.0/6: 83% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6)
1:02.446 finish M eviscerate Fluffy_Pillow 35.4/100: 35% energy | 5.0/6: 83% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6)
1:03.449 stealthed Y shadowstrike Fluffy_Pillow 51.4/100: 51% energy | 0.0/6: 0% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death
1:04.453 stealthed Y shadowstrike Fluffy_Pillow 53.4/100: 53% energy | 2.0/6: 33% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death
1:05.457 Waiting     1.900 sec 30.4/100: 30% energy | 4.0/6: 67% combo_points temptation(4), master_of_subtlety, symbols_of_death
1:07.357 build G backstab Fluffy_Pillow 51.2/100: 51% energy | 4.0/6: 67% combo_points temptation(4), master_of_subtlety, symbols_of_death
1:08.360 Waiting     0.800 sec 27.2/100: 27% energy | 6.0/6: 100% combo_points temptation(4), master_of_subtlety, symbols_of_death
1:09.160 finish M eviscerate Fluffy_Pillow 35.9/100: 36% energy | 6.0/6: 100% combo_points temptation(4), master_of_subtlety, symbols_of_death
1:10.163 stealth_cds V shadow_dance Fluffy_Pillow 51.9/100: 52% energy | 0.0/6: 0% combo_points temptation(4), symbols_of_death, finality_eviscerate(6)
1:10.163 stealthed Y shadowstrike Fluffy_Pillow 76.9/100: 77% energy | 0.0/6: 0% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6)
1:11.169 stealthed Y shadowstrike Fluffy_Pillow 53.9/100: 54% energy | 2.0/6: 33% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6)
1:12.173 Waiting     0.900 sec 30.9/100: 31% energy | 4.0/6: 67% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6)
1:13.073 stealthed Y shadowstrike Fluffy_Pillow 40.8/100: 41% energy | 4.0/6: 67% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6)
1:14.076 Waiting     0.759 sec 17.8/100: 18% energy | 6.0/6: 100% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6), recursive_strikes(3)
1:14.835 finish L nightblade Fluffy_Pillow 26.1/100: 26% energy | 6.0/6: 100% combo_points temptation(4), master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6), recursive_strikes(4)
1:15.839 stealth_cds V shadow_dance Fluffy_Pillow 92.1/100: 92% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(6), finality_nightblade(6), recursive_strikes(4)
1:15.839 stealthed W symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6), finality_nightblade(6), recursive_strikes(4)
1:15.839 stealthed Y shadowstrike Fluffy_Pillow 65.0/100: 65% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, death, finality_eviscerate(6), finality_nightblade(6), recursive_strikes(4)
1:16.844 stealthed Y shadowstrike Fluffy_Pillow 42.0/100: 42% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6), finality_nightblade(6), recursive_strikes(6)
1:17.848 Waiting     1.546 sec 19.0/100: 19% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6), finality_nightblade(6), recursive_strikes(6)
1:19.394 finish M eviscerate Fluffy_Pillow 35.9/100: 36% energy | 5.0/6: 83% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6), finality_nightblade(6), recursive_strikes(7)
1:20.398 stealthed Y shadowstrike Fluffy_Pillow 51.9/100: 52% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(6), recursive_strikes(8)
1:21.402 build G backstab Fluffy_Pillow 53.9/100: 54% energy | 2.0/6: 33% combo_points master_of_subtlety, symbols_of_death, finality_nightblade(6), recursive_strikes(10)
1:22.406 Waiting     2.000 sec 29.9/100: 30% energy | 3.0/6: 50% combo_points master_of_subtlety, symbols_of_death, finality_nightblade(6), recursive_strikes(10)
1:24.406 build G backstab Fluffy_Pillow 51.9/100: 52% energy | 4.0/6: 67% combo_points master_of_subtlety, symbols_of_death, finality_nightblade(6), recursive_strikes(12)
1:25.413 Waiting     0.700 sec 27.9/100: 28% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death, finality_nightblade(6), recursive_strikes(14)
1:26.113 finish M eviscerate Fluffy_Pillow 35.6/100: 36% energy | 5.0/6: 83% combo_points symbols_of_death, finality_nightblade(6), recursive_strikes(14)
1:27.117 build G backstab Fluffy_Pillow 51.5/100: 52% energy | 0.0/6: 0% combo_points symbols_of_death, finality_eviscerate(5), finality_nightblade(6), recursive_strikes(15)
1:28.123 Waiting     2.200 sec 27.6/100: 28% energy | 1.0/6: 17% combo_points symbols_of_death, finality_eviscerate(5), finality_nightblade(6)
1:30.323 build G backstab Fluffy_Pillow 51.7/100: 52% energy | 3.0/6: 50% combo_points symbols_of_death, finality_eviscerate(5), finality_nightblade(6)
1:31.329 Waiting     1.600 sec 27.7/100: 28% energy | 4.0/6: 67% combo_points symbols_of_death, finality_eviscerate(5), finality_nightblade(6)
1:32.929 finish L nightblade Fluffy_Pillow 45.2/100: 45% energy | 5.0/6: 83% combo_points symbols_of_death, finality_eviscerate(5), finality_nightblade(6)
1:33.933 stealth_cds V shadow_dance Fluffy_Pillow 71.2/100: 71% energy | 0.0/6: 0% combo_points symbols_of_death, finality_eviscerate(5)
1:33.933 stealthed Y shadowstrike Fluffy_Pillow 96.2/100: 96% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5)
1:34.938 stealthed Y shadowstrike Fluffy_Pillow 73.2/100: 73% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5)
1:35.944 stealthed Y shadowstrike Fluffy_Pillow 75.2/100: 75% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5)
1:36.951 finish M eviscerate Fluffy_Pillow 52.3/100: 52% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5)
1:37.954 stealthed Y shadowstrike Fluffy_Pillow 68.3/100: 68% energy | 1.0/6: 17% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
1:38.958 Waiting     0.600 sec 45.3/100: 45% energy | 3.0/6: 50% combo_points master_of_subtlety, symbols_of_death
1:39.558 build G backstab Fluffy_Pillow 51.8/100: 52% energy | 3.0/6: 50% combo_points master_of_subtlety, symbols_of_death
1:40.563 Waiting     2.200 sec 27.8/100: 28% energy | 4.0/6: 67% combo_points master_of_subtlety, symbols_of_death
1:42.763 finish M eviscerate Fluffy_Pillow 52.0/100: 52% energy | 6.0/6: 100% combo_points master_of_subtlety, symbols_of_death
1:43.767 stealth_cds V shadow_dance Fluffy_Pillow 67.9/100: 68% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(6)
1:43.767 stealthed Y shadowstrike Fluffy_Pillow 92.9/100: 93% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6)
1:44.770 stealthed Y shadowstrike Fluffy_Pillow 69.9/100: 70% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6)
1:45.774 stealthed Y shadowstrike Fluffy_Pillow 46.9/100: 47% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6)
1:46.779 Waiting     0.200 sec 23.9/100: 24% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6)
1:46.979 finish L nightblade Fluffy_Pillow 26.1/100: 26% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6)
1:47.983 stealthed Y shadowstrike Fluffy_Pillow 52.1/100: 52% energy | 1.0/6: 17% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6), finality_nightblade(6)
1:48.988 Waiting     2.000 sec 29.1/100: 29% energy | 3.0/6: 50% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(6), finality_nightblade(6)
1:50.988 build G backstab Fluffy_Pillow 51.1/100: 51% energy | 4.0/6: 67% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(6), finality_nightblade(6)
1:51.993 Waiting     0.800 sec 27.1/100: 27% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(6), finality_nightblade(6)
1:52.793 finish M eviscerate Fluffy_Pillow 35.8/100: 36% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(6), finality_nightblade(6)
1:53.798 cds K goremaws_bite Fluffy_Pillow 51.8/100: 52% energy | 0.0/6: 0% combo_points symbols_of_death, finality_nightblade(6)
1:54.802 build G backstab Fluffy_Pillow 67.8/100: 68% energy | 3.0/6: 50% combo_points symbols_of_death, goremaws_bite, finality_nightblade(6)
1:55.806 Waiting     0.200 sec 48.8/100: 49% energy | 4.0/6: 67% combo_points symbols_of_death, goremaws_bite, finality_nightblade(6)
1:56.006 build G backstab Fluffy_Pillow 51.0/100: 51% energy | 4.0/6: 67% combo_points symbols_of_death, goremaws_bite, finality_nightblade(6)
1:57.010 Waiting     0.300 sec 32.0/100: 32% energy | 5.0/6: 83% combo_points symbols_of_death, goremaws_bite, finality_nightblade(6), fiery_enchant
1:57.310 finish M eviscerate Fluffy_Pillow 35.3/100: 35% energy | 5.0/6: 83% combo_points symbols_of_death, goremaws_bite, finality_nightblade(6), fiery_enchant
1:58.314 stealth_cds V shadow_dance Fluffy_Pillow 56.3/100: 56% energy | 0.0/6: 0% combo_points symbols_of_death, goremaws_bite, finality_eviscerate(5), finality_nightblade(6), fiery_enchant
1:58.314 stealthed W symbols_of_death Fluffy_Pillow 81.3/100: 81% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, goremaws_bite, finality_eviscerate(5), finality_nightblade(6), fiery_enchant
1:58.314 stealthed Y shadowstrike Fluffy_Pillow 46.3/100: 46% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, goremaws_bite, death, finality_eviscerate(5), finality_nightblade(6), fiery_enchant
1:59.318 Waiting     0.700 sec 28.3/100: 28% energy | 3.0/6: 50% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, goremaws_bite, finality_eviscerate(5), finality_nightblade(6), fiery_enchant
2:00.018 stealthed Y shadowstrike Fluffy_Pillow 41.0/100: 41% energy | 3.0/6: 50% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5), finality_nightblade(6), fiery_enchant
2:01.022 Waiting     1.141 sec 18.0/100: 18% energy | 5.0/6: 83% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5), finality_nightblade(6), fiery_enchant
2:02.163 finish L nightblade Fluffy_Pillow 30.5/100: 30% energy | 5.0/6: 83% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5), finality_nightblade(6), fiery_enchant
2:03.167 stealthed Y shadowstrike Fluffy_Pillow 56.5/100: 56% energy | 1.0/6: 17% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5), fiery_enchant
2:04.173 Waiting     1.600 sec 33.5/100: 33% energy | 3.0/6: 50% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5), fiery_enchant
2:05.773 build G backstab Fluffy_Pillow 51.0/100: 51% energy | 4.0/6: 67% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5), fiery_enchant
2:06.779 Waiting     0.800 sec 27.0/100: 27% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5), fiery_enchant
2:07.579 finish M eviscerate Fluffy_Pillow 35.8/100: 36% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5), fiery_enchant
2:08.583 build G backstab Fluffy_Pillow 51.8/100: 52% energy | 0.0/6: 0% combo_points symbols_of_death, fiery_enchant
2:09.588 Waiting     2.200 sec 27.8/100: 28% energy | 1.0/6: 17% combo_points symbols_of_death, fiery_enchant
2:11.788 build G backstab Fluffy_Pillow 51.9/100: 52% energy | 2.0/6: 33% combo_points symbols_of_death, fiery_enchant
2:12.791 Waiting     2.200 sec 27.9/100: 28% energy | 3.0/6: 50% combo_points symbols_of_death, fiery_enchant
2:14.991 build G backstab Fluffy_Pillow 52.0/100: 52% energy | 4.0/6: 67% combo_points symbols_of_death, fiery_enchant
2:15.998 Waiting     0.700 sec 28.0/100: 28% energy | 5.0/6: 83% combo_points symbols_of_death, fiery_enchant
2:16.698 finish M eviscerate Fluffy_Pillow 35.7/100: 36% energy | 5.0/6: 83% combo_points symbols_of_death
2:17.703 stealth_cds V shadow_dance Fluffy_Pillow 51.7/100: 52% energy | 1.0/6: 17% combo_points symbols_of_death, finality_eviscerate(5)
2:17.703 stealthed Y shadowstrike Fluffy_Pillow 76.7/100: 77% energy | 1.0/6: 17% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5)
2:18.708 stealthed Y shadowstrike Fluffy_Pillow 53.7/100: 54% energy | 3.0/6: 50% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5)
2:19.712 Waiting     0.400 sec 30.7/100: 31% energy | 5.0/6: 83% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5)
2:20.112 finish M eviscerate Fluffy_Pillow 35.1/100: 35% energy | 5.0/6: 83% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5)
2:21.118 stealthed Y shadowstrike Fluffy_Pillow 51.1/100: 51% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
2:22.121 Waiting     2.100 sec 28.1/100: 28% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
2:24.221 stealth_cds S vanish Fluffy_Pillow 51.1/100: 51% energy | 3.0/6: 50% combo_points master_of_subtlety, symbols_of_death
2:24.221 stealthed Y shadowstrike Fluffy_Pillow 76.1/100: 76% energy | 3.0/6: 50% combo_points master_of_subtlety_aura, vanish, symbols_of_death
2:25.226 finish L nightblade Fluffy_Pillow 53.1/100: 53% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, vanish, subterfuge, symbols_of_death
2:26.230 stealthed W symbols_of_death Fluffy_Pillow 79.1/100: 79% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, vanish, subterfuge, symbols_of_death, finality_nightblade(6)
2:26.230 stealthed Y shadowstrike Fluffy_Pillow 44.1/100: 44% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, vanish, subterfuge, symbols_of_death, death, finality_nightblade(6)
2:27.233 stealth_cds T sprint Fluffy_Pillow 71.1/100: 71% energy | 2.0/6: 33% combo_points master_of_subtlety, symbols_of_death, finality_nightblade(6)
2:27.233 build G backstab Fluffy_Pillow 71.1/100: 71% energy | 2.0/6: 33% combo_points master_of_subtlety, sprint, symbols_of_death, finality_nightblade(6), faster_than_light_trigger
2:28.237 Waiting     0.400 sec 47.1/100: 47% energy | 3.0/6: 50% combo_points master_of_subtlety, sprint, symbols_of_death, finality_nightblade(6), faster_than_light_trigger
2:28.637 build G backstab Fluffy_Pillow 51.5/100: 51% energy | 3.0/6: 50% combo_points master_of_subtlety, sprint, symbols_of_death, finality_nightblade(6), faster_than_light_trigger
2:29.641 Waiting     0.600 sec 27.5/100: 27% energy | 4.0/6: 67% combo_points master_of_subtlety, sprint, symbols_of_death, finality_nightblade(6), faster_than_light_trigger
2:30.241 stealthed Y shadowstrike Fluffy_Pillow 59.1/100: 59% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, vanish, subterfuge, sprint, symbols_of_death, finality_nightblade(6)
2:31.246 finish M eviscerate Fluffy_Pillow 36.1/100: 36% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, vanish, subterfuge, sprint, symbols_of_death, finality_nightblade(6)
2:32.251 stealthed Y shadowstrike Fluffy_Pillow 52.1/100: 52% energy | 1.0/6: 17% combo_points master_of_subtlety_aura, vanish, subterfuge, sprint, symbols_of_death, finality_eviscerate(6), finality_nightblade(6)
2:33.255 build G backstab Fluffy_Pillow 79.1/100: 79% energy | 3.0/6: 50% combo_points master_of_subtlety, sprint, symbols_of_death, finality_eviscerate(6), finality_nightblade(6)
2:34.261 build G backstab Fluffy_Pillow 55.1/100: 55% energy | 4.0/6: 67% combo_points master_of_subtlety, sprint, symbols_of_death, finality_eviscerate(6), finality_nightblade(6)
2:35.265 Waiting     0.400 sec 31.1/100: 31% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(6), finality_nightblade(6)
2:35.665 finish M eviscerate Fluffy_Pillow 35.5/100: 35% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(6), finality_nightblade(6)
2:36.670 stealth_cds V shadow_dance Fluffy_Pillow 51.5/100: 51% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, finality_nightblade(6)
2:36.670 stealthed Y shadowstrike Fluffy_Pillow 76.5/100: 76% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(6)
2:37.673 stealthed Y shadowstrike Fluffy_Pillow 53.5/100: 53% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(6)
2:38.677 Waiting     0.900 sec 30.5/100: 30% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(6)
2:39.577 stealthed Y shadowstrike Fluffy_Pillow 40.3/100: 40% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(6)
2:40.581 Waiting     0.616 sec 18.7/100: 19% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(6), arcane_enchant
2:41.197 finish L nightblade Fluffy_Pillow 26.2/100: 26% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(6), arcane_enchant
2:42.203 stealth_cds V shadow_dance Fluffy_Pillow 53.6/100: 54% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, arcane_enchant
2:42.203 stealthed Y shadowstrike Fluffy_Pillow 78.6/100: 79% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, arcane_enchant
2:43.208 stealthed Y shadowstrike Fluffy_Pillow 56.9/100: 57% energy | 3.0/6: 50% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, arcane_enchant
2:44.211 finish M eviscerate Fluffy_Pillow 60.2/100: 60% energy | 5.0/6: 83% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, arcane_enchant
2:45.216 stealthed Y shadowstrike Fluffy_Pillow 77.5/100: 78% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5), arcane_enchant
2:46.222 stealthed Y shadowstrike Fluffy_Pillow 55.9/100: 56% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5), arcane_enchant
2:47.226 Waiting     0.200 sec 34.2/100: 34% energy | 4.0/6: 67% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5), arcane_enchant
2:47.426 finish M eviscerate Fluffy_Pillow 36.6/100: 37% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5), arcane_enchant
2:48.430 build G backstab Fluffy_Pillow 54.0/100: 54% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, arcane_enchant
2:49.435 Waiting     1.700 sec 31.3/100: 31% energy | 1.0/6: 17% combo_points master_of_subtlety, symbols_of_death, arcane_enchant
2:51.135 build G backstab Fluffy_Pillow 52.1/100: 52% energy | 1.0/6: 17% combo_points master_of_subtlety, symbols_of_death, arcane_enchant
2:52.140 Waiting     1.800 sec 29.5/100: 29% energy | 2.0/6: 33% combo_points master_of_subtlety, symbols_of_death, arcane_enchant
2:53.940 build G backstab Fluffy_Pillow 51.6/100: 52% energy | 3.0/6: 50% combo_points symbols_of_death, arcane_enchant
2:54.943 Waiting     1.900 sec 28.9/100: 29% energy | 4.0/6: 67% combo_points symbols_of_death, arcane_enchant
2:56.843 build G backstab Fluffy_Pillow 52.2/100: 52% energy | 4.0/6: 67% combo_points symbols_of_death, arcane_enchant
2:57.847 Waiting     0.500 sec 29.5/100: 29% energy | 5.0/6: 83% combo_points symbols_of_death, arcane_enchant
2:58.347 finish M eviscerate Fluffy_Pillow 35.6/100: 36% energy | 5.0/6: 83% combo_points symbols_of_death, arcane_enchant
2:59.351 cds K goremaws_bite Fluffy_Pillow 52.9/100: 53% energy | 2.0/6: 33% combo_points symbols_of_death, finality_eviscerate(5), fiery_enchant, arcane_enchant
3:00.354 cds J shadow_blades Fluffy_Pillow 69.2/100: 69% energy | 5.0/6: 83% combo_points symbols_of_death, goremaws_bite, finality_eviscerate(5), fiery_enchant
3:00.354 cds H potion Fluffy_Pillow 69.2/100: 69% energy | 5.0/6: 83% combo_points symbols_of_death, shadow_blades, goremaws_bite, finality_eviscerate(5), fiery_enchant
3:00.354 finish L nightblade Fluffy_Pillow 69.2/100: 69% energy | 5.0/6: 83% combo_points symbols_of_death, shadow_blades, goremaws_bite, finality_eviscerate(5), fiery_enchant, potion_of_the_old_war
3:01.358 stealth_cds V shadow_dance Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points symbols_of_death, shadow_blades, goremaws_bite, finality_eviscerate(5), finality_nightblade(5), recursive_strikes(3), fiery_enchant, potion_of_the_old_war
3:01.358 stealthed W symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, goremaws_bite, finality_eviscerate(5), finality_nightblade(5), recursive_strikes(3), fiery_enchant, potion_of_the_old_war
3:01.358 stealthed Y shadowstrike Fluffy_Pillow 65.0/100: 65% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, goremaws_bite, death, finality_eviscerate(5), finality_nightblade(5), recursive_strikes(3), fiery_enchant, potion_of_the_old_war
3:02.363 stealthed Y shadowstrike Fluffy_Pillow 47.0/100: 47% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, goremaws_bite, finality_eviscerate(5), finality_nightblade(5), recursive_strikes(5), fiery_enchant, potion_of_the_old_war
3:03.368 Waiting     0.600 sec 29.0/100: 29% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, goremaws_bite, finality_eviscerate(5), finality_nightblade(5), recursive_strikes(5), fiery_enchant, potion_of_the_old_war
3:03.968 finish M eviscerate Fluffy_Pillow 35.6/100: 36% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, goremaws_bite, finality_eviscerate(5), finality_nightblade(5), recursive_strikes(5), fiery_enchant, potion_of_the_old_war
3:04.971 stealthed Y shadowstrike Fluffy_Pillow 56.6/100: 57% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, goremaws_bite, finality_nightblade(5), recursive_strikes(7), fiery_enchant, potion_of_the_old_war
3:05.977 Waiting     0.200 sec 38.6/100: 39% energy | 3.0/6: 50% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(5), recursive_strikes(9), fiery_enchant, potion_of_the_old_war
3:06.177 stealthed Y shadowstrike Fluffy_Pillow 40.8/100: 41% energy | 3.0/6: 50% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(5), recursive_strikes(9), fiery_enchant, potion_of_the_old_war
3:07.181 finish M eviscerate Fluffy_Pillow 42.8/100: 43% energy | 6.0/6: 100% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_nightblade(5), recursive_strikes(9), fiery_enchant, potion_of_the_old_war
3:08.185 stealth_cds V shadow_dance Fluffy_Pillow 58.8/100: 59% energy | 1.0/6: 17% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(5), recursive_strikes(11), fiery_enchant, potion_of_the_old_war
3:08.185 stealthed Y shadowstrike Fluffy_Pillow 83.8/100: 84% energy | 1.0/6: 17% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(5), recursive_strikes(11), fiery_enchant, potion_of_the_old_war
3:09.189 stealthed Y shadowstrike Fluffy_Pillow 60.8/100: 61% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(5), recursive_strikes(13), fiery_enchant, potion_of_the_old_war
3:10.193 finish M eviscerate Fluffy_Pillow 62.8/100: 63% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(5), recursive_strikes(13), fiery_enchant, potion_of_the_old_war
3:11.198 stealthed W symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(5), recursive_strikes(15), fiery_enchant, potion_of_the_old_war
3:11.358 stealthed Y shadowstrike Fluffy_Pillow 65.0/100: 65% energy | 1.0/6: 17% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, death, finality_nightblade(5), recursive_strikes(15), fiery_enchant, potion_of_the_old_war
3:12.364 stealthed Y shadowstrike Fluffy_Pillow 67.0/100: 67% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(5), recursive_strikes(15), fiery_enchant, potion_of_the_old_war
3:13.369 finish L nightblade Fluffy_Pillow 44.0/100: 44% energy | 6.0/6: 100% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_nightblade(5), recursive_strikes(15), fiery_enchant, potion_of_the_old_war
3:14.374 build G backstab Fluffy_Pillow 70.0/100: 70% energy | 1.0/6: 17% combo_points master_of_subtlety, symbols_of_death, shadow_blades, recursive_strikes(15), fiery_enchant, potion_of_the_old_war
3:15.379 Waiting     0.500 sec 46.0/100: 46% energy | 3.0/6: 50% combo_points master_of_subtlety, symbols_of_death, shadow_blades, fiery_enchant, potion_of_the_old_war
3:15.879 build G backstab Fluffy_Pillow 51.5/100: 52% energy | 3.0/6: 50% combo_points master_of_subtlety, symbols_of_death, shadow_blades, fiery_enchant, potion_of_the_old_war
3:16.885 Waiting     0.700 sec 27.5/100: 28% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death, shadow_blades, fiery_enchant, potion_of_the_old_war
3:17.585 finish M eviscerate Fluffy_Pillow 35.2/100: 35% energy | 6.0/6: 100% combo_points master_of_subtlety, symbols_of_death, shadow_blades, fiery_enchant, potion_of_the_old_war
3:18.590 stealth_cds V shadow_dance Fluffy_Pillow 51.2/100: 51% energy | 0.0/6: 0% combo_points symbols_of_death, shadow_blades, finality_eviscerate(6), fiery_enchant, potion_of_the_old_war
3:18.590 stealthed Y shadowstrike Fluffy_Pillow 76.2/100: 76% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), fiery_enchant, potion_of_the_old_war
3:19.593 stealthed Y shadowstrike Fluffy_Pillow 53.2/100: 53% energy | 3.0/6: 50% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), potion_of_the_old_war
3:20.597 finish M eviscerate Fluffy_Pillow 55.2/100: 55% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), potion_of_the_old_war
3:21.599 stealthed W symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, potion_of_the_old_war
3:21.599 stealthed Y shadowstrike Fluffy_Pillow 65.0/100: 65% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, death, potion_of_the_old_war
3:22.602 stealthed Y shadowstrike Fluffy_Pillow 42.0/100: 42% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, potion_of_the_old_war
3:23.606 Waiting     1.548 sec 19.0/100: 19% energy | 6.0/6: 100% combo_points master_of_subtlety, symbols_of_death, shadow_blades, potion_of_the_old_war
3:25.154 finish M eviscerate Fluffy_Pillow 35.9/100: 36% energy | 6.0/6: 100% combo_points master_of_subtlety, symbols_of_death, shadow_blades, potion_of_the_old_war
3:26.158 build G backstab Fluffy_Pillow 91.9/100: 92% energy | 1.0/6: 17% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6)
3:27.162 build G backstab Fluffy_Pillow 67.9/100: 68% energy | 3.0/6: 50% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6)
3:28.167 finish M eviscerate Fluffy_Pillow 44.0/100: 44% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6)
3:29.172 stealth_cds V shadow_dance Fluffy_Pillow 60.0/100: 60% energy | 1.0/6: 17% combo_points symbols_of_death, shadow_blades
3:29.172 stealthed Y shadowstrike Fluffy_Pillow 85.0/100: 85% energy | 1.0/6: 17% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades
3:30.176 stealthed Y shadowstrike Fluffy_Pillow 62.0/100: 62% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades
3:31.180 finish M eviscerate Fluffy_Pillow 39.0/100: 39% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades
3:32.185 stealthed Y shadowstrike Fluffy_Pillow 55.0/100: 55% energy | 1.0/6: 17% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6)
3:33.190 Waiting     0.800 sec 32.0/100: 32% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6)
3:33.990 stealthed Y shadowstrike Fluffy_Pillow 40.7/100: 41% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6)
3:34.995 Waiting     0.761 sec 17.8/100: 18% energy | 6.0/6: 100% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6)
3:35.756 finish L nightblade Fluffy_Pillow 26.1/100: 26% energy | 6.0/6: 100% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6)
3:36.759 build G backstab Fluffy_Pillow 52.1/100: 52% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6)
3:37.763 Waiting     2.100 sec 28.1/100: 28% energy | 2.0/6: 33% combo_points master_of_subtlety, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6)
3:39.863 build G backstab Fluffy_Pillow 51.1/100: 51% energy | 3.0/6: 50% combo_points symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6)
3:40.868 Waiting     0.800 sec 27.1/100: 27% energy | 5.0/6: 83% combo_points symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6)
3:41.668 finish M eviscerate Fluffy_Pillow 35.9/100: 36% energy | 5.0/6: 83% combo_points symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6)
3:42.672 stealth_cds V shadow_dance Fluffy_Pillow 51.9/100: 52% energy | 1.0/6: 17% combo_points symbols_of_death, shadow_blades, finality_nightblade(6), fiery_enchant
3:42.672 stealthed Y shadowstrike Fluffy_Pillow 76.9/100: 77% energy | 1.0/6: 17% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6), fiery_enchant
3:43.677 stealthed Y shadowstrike Fluffy_Pillow 53.9/100: 54% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6), fiery_enchant
3:44.678 Waiting     0.400 sec 30.8/100: 31% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6), fiery_enchant
3:45.078 finish M eviscerate Fluffy_Pillow 35.2/100: 35% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6), fiery_enchant
3:46.082 stealthed Y shadowstrike Fluffy_Pillow 51.2/100: 51% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6), fiery_enchant
3:47.086 Waiting     2.100 sec 28.2/100: 28% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6), fiery_enchant
3:49.186 build G backstab Fluffy_Pillow 51.2/100: 51% energy | 4.0/6: 67% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(6), finality_nightblade(6), fiery_enchant
3:50.189 finish L nightblade Fluffy_Pillow 27.2/100: 27% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(6), finality_nightblade(6), fiery_enchant
3:51.194 build G backstab Fluffy_Pillow 53.2/100: 53% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(6), fiery_enchant
3:52.198 Waiting     2.000 sec 29.2/100: 29% energy | 1.0/6: 17% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(6), fiery_enchant
3:54.198 build G backstab Fluffy_Pillow 51.1/100: 51% energy | 3.0/6: 50% combo_points symbols_of_death, finality_eviscerate(6), fiery_enchant
3:55.203 Waiting     2.200 sec 27.1/100: 27% energy | 4.0/6: 67% combo_points symbols_of_death, finality_eviscerate(6), fiery_enchant
3:57.403 build G backstab Fluffy_Pillow 51.2/100: 51% energy | 4.0/6: 67% combo_points symbols_of_death, finality_eviscerate(6), fiery_enchant, frost_enchant
3:58.407 Waiting     0.800 sec 27.2/100: 27% energy | 6.0/6: 100% combo_points symbols_of_death, finality_eviscerate(6), fiery_enchant, frost_enchant
3:59.207 finish M eviscerate Fluffy_Pillow 36.0/100: 36% energy | 6.0/6: 100% combo_points symbols_of_death, finality_eviscerate(6), fiery_enchant, frost_enchant
4:00.214 cds K goremaws_bite Fluffy_Pillow 52.0/100: 52% energy | 0.0/6: 0% combo_points symbols_of_death, fiery_enchant, frost_enchant
4:01.221 build G backstab Fluffy_Pillow 68.1/100: 68% energy | 3.0/6: 50% combo_points symbols_of_death, goremaws_bite, fiery_enchant, frost_enchant
4:02.225 Waiting     0.200 sec 49.1/100: 49% energy | 4.0/6: 67% combo_points symbols_of_death, goremaws_bite, frost_enchant
4:02.425 build G backstab Fluffy_Pillow 51.2/100: 51% energy | 4.0/6: 67% combo_points symbols_of_death, goremaws_bite, frost_enchant
4:03.429 Waiting     0.300 sec 32.2/100: 32% energy | 6.0/6: 100% combo_points symbols_of_death, goremaws_bite, recursive_strikes(2), frost_enchant
4:03.729 finish M eviscerate Fluffy_Pillow 35.5/100: 36% energy | 6.0/6: 100% combo_points symbols_of_death, goremaws_bite, recursive_strikes(2), frost_enchant
4:04.735 stealth_cds V shadow_dance Fluffy_Pillow 96.6/100: 97% energy | 0.0/6: 0% combo_points symbols_of_death, goremaws_bite, finality_eviscerate(6), recursive_strikes(2), frost_enchant
4:04.735 stealthed W symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, goremaws_bite, finality_eviscerate(6), recursive_strikes(2), frost_enchant
4:04.735 stealthed Y shadowstrike Fluffy_Pillow 65.0/100: 65% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, goremaws_bite, death, finality_eviscerate(6), recursive_strikes(2), frost_enchant
4:05.740 stealthed Y shadowstrike Fluffy_Pillow 47.0/100: 47% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, goremaws_bite, finality_eviscerate(6), recursive_strikes(4), frost_enchant
4:06.745 Waiting     0.600 sec 29.0/100: 29% energy | 5.0/6: 83% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6), recursive_strikes(6), frost_enchant
4:07.345 finish M eviscerate Fluffy_Pillow 35.6/100: 36% energy | 5.0/6: 83% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6), recursive_strikes(6), frost_enchant
4:08.350 stealthed Y shadowstrike Fluffy_Pillow 51.6/100: 52% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, recursive_strikes(7), frost_enchant
4:09.354 Waiting     2.100 sec 28.6/100: 29% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, recursive_strikes(7), frost_enchant
4:11.454 build G backstab Fluffy_Pillow 51.6/100: 52% energy | 3.0/6: 50% combo_points master_of_subtlety, symbols_of_death, recursive_strikes(11), frost_enchant
4:12.458 Waiting     2.200 sec 27.6/100: 28% energy | 4.0/6: 67% combo_points master_of_subtlety, symbols_of_death, recursive_strikes(11), frost_enchant
4:14.658 finish L nightblade Fluffy_Pillow 51.7/100: 52% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death, recursive_strikes(15), frost_enchant
4:15.663 stealth_cds V shadow_dance Fluffy_Pillow 77.7/100: 78% energy | 0.0/6: 0% combo_points symbols_of_death, finality_nightblade(5), recursive_strikes(15), frost_enchant
4:15.663 stealthed W symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(5), recursive_strikes(15), frost_enchant
4:15.663 stealthed Y shadowstrike Fluffy_Pillow 65.0/100: 65% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, death, finality_nightblade(5), recursive_strikes(15), frost_enchant
4:16.668 stealthed Y shadowstrike Fluffy_Pillow 42.0/100: 42% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(5), recursive_strikes(15)
4:17.673 Waiting     1.945 sec 19.0/100: 19% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(5), recursive_strikes(15)
4:19.618 finish M eviscerate Fluffy_Pillow 40.3/100: 40% energy | 5.0/6: 83% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_nightblade(5)
4:20.621 stealthed Y shadowstrike Fluffy_Pillow 56.3/100: 56% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5), finality_nightblade(5)
4:21.626 Waiting     1.700 sec 33.3/100: 33% energy | 2.0/6: 33% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5), finality_nightblade(5)
4:23.326 build G backstab Fluffy_Pillow 51.9/100: 52% energy | 2.0/6: 33% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5), finality_nightblade(5)
4:24.331 Waiting     2.200 sec 28.0/100: 28% energy | 3.0/6: 50% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5), finality_nightblade(5)
4:26.531 stealth_cds S vanish Fluffy_Pillow 52.1/100: 52% energy | 3.0/6: 50% combo_points symbols_of_death, finality_eviscerate(5), finality_nightblade(5)
4:26.531 stealthed Y shadowstrike Fluffy_Pillow 77.1/100: 77% energy | 3.0/6: 50% combo_points master_of_subtlety_aura, vanish, symbols_of_death, finality_eviscerate(5), finality_nightblade(5)
4:27.537 finish L nightblade Fluffy_Pillow 54.1/100: 54% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, vanish, subterfuge, symbols_of_death, finality_eviscerate(5), finality_nightblade(5)
4:28.540 stealthed W symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, vanish, subterfuge, symbols_of_death, finality_eviscerate(5)
4:28.540 stealthed Y shadowstrike Fluffy_Pillow 65.0/100: 65% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, vanish, subterfuge, symbols_of_death, death, finality_eviscerate(5)
4:29.546 stealth_cds T sprint Fluffy_Pillow 67.0/100: 67% energy | 2.0/6: 33% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5)
4:29.546 build G backstab Fluffy_Pillow 67.0/100: 67% energy | 2.0/6: 33% combo_points master_of_subtlety, sprint, symbols_of_death, finality_eviscerate(5), faster_than_light_trigger
4:30.552 Waiting     0.800 sec 43.0/100: 43% energy | 3.0/6: 50% combo_points master_of_subtlety, sprint, symbols_of_death, finality_eviscerate(5), faster_than_light_trigger
4:31.352 build G backstab Fluffy_Pillow 51.8/100: 52% energy | 3.0/6: 50% combo_points master_of_subtlety, sprint, symbols_of_death, finality_eviscerate(5), faster_than_light_trigger
4:32.357 Waiting     0.200 sec 27.8/100: 28% energy | 4.0/6: 67% combo_points master_of_subtlety, sprint, symbols_of_death, finality_eviscerate(5), faster_than_light_trigger
4:32.557 stealthed Y shadowstrike Fluffy_Pillow 55.0/100: 55% energy | 4.0/6: 67% combo_points master_of_subtlety_aura, vanish, subterfuge, sprint, symbols_of_death, finality_eviscerate(5)
4:33.561 Waiting     0.300 sec 32.0/100: 32% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, vanish, subterfuge, sprint, symbols_of_death, finality_eviscerate(5)
4:33.861 finish M eviscerate Fluffy_Pillow 35.3/100: 35% energy | 6.0/6: 100% combo_points master_of_subtlety_aura, vanish, subterfuge, sprint, symbols_of_death, finality_eviscerate(5)
4:34.867 stealthed Y shadowstrike Fluffy_Pillow 91.3/100: 91% energy | 1.0/6: 17% combo_points master_of_subtlety_aura, vanish, subterfuge, sprint, symbols_of_death
4:35.870 build G backstab Fluffy_Pillow 93.3/100: 93% energy | 3.0/6: 50% combo_points master_of_subtlety, sprint, symbols_of_death
4:36.875 build G backstab Fluffy_Pillow 69.3/100: 69% energy | 4.0/6: 67% combo_points master_of_subtlety, sprint, symbols_of_death
4:37.879 finish M eviscerate Fluffy_Pillow 45.3/100: 45% energy | 5.0/6: 83% combo_points master_of_subtlety, symbols_of_death
4:38.884 stealth_cds V shadow_dance Fluffy_Pillow 61.3/100: 61% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(5)
4:38.884 stealthed Y shadowstrike Fluffy_Pillow 86.3/100: 86% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5)
4:39.888 stealthed Y shadowstrike Fluffy_Pillow 63.3/100: 63% energy | 3.0/6: 50% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5)
4:40.892 finish M eviscerate Fluffy_Pillow 40.3/100: 40% energy | 5.0/6: 83% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(5)
4:41.897 stealthed Y shadowstrike Fluffy_Pillow 56.3/100: 56% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
4:42.899 Waiting     0.700 sec 33.3/100: 33% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
4:43.599 stealthed Y shadowstrike Fluffy_Pillow 41.0/100: 41% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
4:44.605 Waiting     1.639 sec 18.0/100: 18% energy | 6.0/6: 100% combo_points master_of_subtlety, symbols_of_death
4:46.244 finish M eviscerate Fluffy_Pillow 35.9/100: 36% energy | 6.0/6: 100% combo_points master_of_subtlety, symbols_of_death
4:47.248 stealth_cds V shadow_dance Fluffy_Pillow 51.9/100: 52% energy | 0.0/6: 0% combo_points master_of_subtlety, symbols_of_death, finality_eviscerate(6)
4:47.248 stealthed Y shadowstrike Fluffy_Pillow 76.9/100: 77% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6)
4:48.254 stealthed Y shadowstrike Fluffy_Pillow 54.0/100: 54% energy | 3.0/6: 50% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6)
4:49.257 Waiting     0.400 sec 31.0/100: 31% energy | 5.0/6: 83% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6)
4:49.657 finish M eviscerate Fluffy_Pillow 35.3/100: 35% energy | 5.0/6: 83% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death, finality_eviscerate(6)
4:50.661 stealthed Y shadowstrike Fluffy_Pillow 51.3/100: 51% energy | 0.0/6: 0% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death
4:51.665 Waiting     1.800 sec 28.3/100: 28% energy | 2.0/6: 33% combo_points master_of_subtlety_aura, shadow_dance, symbols_of_death

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 8806 8481 0
Agility 32993 31287 20768 (13012)
Stamina 48391 48391 28183
Intellect 5325 5000 0
Spirit 0 0 0
Health 2903460 2903460 0
Energy 100 100 0
Combo Points 6 6 0
Crit 23.64% 23.64% 5456
Haste 9.55% 9.55% 3581
Damage / Heal Versatility 9.03% 8.23% 3909
Attack Power 32993 31287 0
Mastery 80.81% 80.81% 8510
Armor 2297 2297 2297
Run Speed 8 0 0

Gear

Source Slot Average Item Level: 891.00
Local Head Cowl of Fright
ilevel: 885, stats: { 300 Armor, +2829 Sta, +1886 AgiInt, +1015 Mastery, +547 Crit, +1076 unknown }
Local Neck Sea Fan Pendant
ilevel: 880, stats: { +1519 Sta, +1633 Vers, +965 Mastery }, enchant: mark_of_the_hidden_satyr
Local Shoulders Steelgazer Hide Mantle
ilevel: 880, stats: { 273 Armor, +1351 AgiInt, +2027 Sta, +673 Haste, +476 Vers, +771 unknown }
Local Shirt Common Gray Shirt
ilevel: 1
Local Chest Biornskin Vest
ilevel: 890, stats: { 376 Armor, +1977 AgiInt, +2965 Sta, +1034 Crit, +557 Mastery }
Local Waist Strand of Whelk Shells
ilevel: 880, stats: { 205 Armor, +2026 Sta, +1351 AgiInt, +673 Haste, +476 Mastery }, gems: { +150 Mastery }
Local Legs Legwraps of Unworthy Souls
ilevel: 880, stats: { 318 Armor, +2701 Sta, +1801 AgiInt, +964 Mastery, +570 Haste }
Local Feet Shadow Satyr's Walk
ilevel: 910, stats: { 276 Armor, +2680 Sta, +1786 Agi, +827 Haste, +459 Mastery }
Local Wrists Denial of the Half-Giants
ilevel: 910, stats: { 176 Armor, +2010 Sta, +1340 Agi, +276 Crit, +689 Mastery }
Local Hands Cruel Vice Grips
ilevel: 885, stats: { 231 Armor, +2122 Sta, +1415 AgiInt, +686 Crit, +485 Mastery }
Local Finger1 Grubby Silver Ring
ilevel: 880, stats: { +1519 Sta, +1484 Crit, +1114 Vers }, gems: { +150 Vers }, enchant: { +200 Mastery }
Local Finger2 Ring of Collapsing Futures
ilevel: 870, stats: { +1385 Sta, +1677 Mastery, +768 Haste, +419 Avoidance }, enchant: { +200 Vers }
Local Trinket1 Nightblooming Frond
ilevel: 910, stats: { +2264 Agi }
Local Trinket2 Entwined Elemental Foci
ilevel: 910, stats: { +2264 StrAgi }
Local Back Drape of the Mana-Starved
ilevel: 875, stats: { 142 Armor, +1450 Sta, +967 StrAgiInt, +586 Crit, +259 Vers }, gems: { +200 Agi }, enchant: { +200 Agi }
Local Main Hand Fangs of the Devourer
ilevel: 906, weapon: { 3844 - 7140, 1.8 }, stats: { +983 Agi, +1475 Sta, +368 Crit, +353 Mastery }, relics: { +53 ilevels, +51 ilevels, +52 ilevels }
Local Off Hand Fangs of the Devourer
ilevel: 906, weapon: { 3844 - 7140, 1.8 }, stats: { +983 Agi, +1475 Sta, +368 Crit, +353 Mastery }

Talents

Level
15 Master of Subtlety (Subtlety Rogue) Weaponmaster (Subtlety Rogue) Gloomblade (Subtlety Rogue)
30 Nightstalker Subterfuge Shadow Focus
45 Deeper Stratagem Anticipation Vigor
60 Soothing Darkness (Subtlety Rogue) Elusiveness Cheat Death
75 Strike from the Shadows (Subtlety Rogue) Prey on the Weak Tangled Shadow (Subtlety Rogue)
90 Premeditation (Subtlety Rogue) Alacrity Enveloping Shadows (Subtlety Rogue)
100 Master of Shadows (Subtlety Rogue) Marked for Death Death from Above

Profile

rogue="NF+EEF"
origin="https://eu.api.battle.net/wow/character/dalaran/Esdeåth/advanced"
level=110
race=human
role=attack
position=back
professions=alchemy=800/enchanting=133
talents=1210011
artifact=17:0:0:0:0:851:1:852:3:853:3:854:3:855:3:856:3:857:3:858:3:859:3:860:3:861:1:862:1:863:1:864:1:865:1:866:1:1349:1:1386:14
spec=subtlety

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,name=flask_of_the_seventh_demon
actions.precombat+=/augmentation,name=defiled
actions.precombat+=/food,name=seedbattered_fish_plate
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/stealth
actions.precombat+=/potion,name=old_war
actions.precombat+=/marked_for_death,if=raid_event.adds.in>40
# Defined variables that doesn't change during the fight
actions.precombat+=/variable,name=ssw_refund,value=equipped.shadow_satyrs_walk*(4+ssw_refund_offset)
actions.precombat+=/variable,name=stealth_threshold,value=(15+talent.vigor.enabled*35+talent.master_of_shadows.enabled*30+variable.ssw_refund)
actions.precombat+=/enveloping_shadows,if=combo_points>=5
actions.precombat+=/symbols_of_death

# Executed every time the actor is available.
actions=call_action_list,name=cds
# Fully switch to the Stealthed Rotation (by doing so, it forces pooling if nothing is available)
actions+=/run_action_list,name=stealthed,if=stealthed.all
actions+=/call_action_list,name=finish,if=combo_points>=5|(combo_points>=4&spell_targets.shuriken_storm>=3&spell_targets.shuriken_storm<=4)
actions+=/call_action_list,name=stealth_als,if=combo_points.deficit>=2+talent.premeditation.enabled
actions+=/call_action_list,name=build,if=energy.deficit<=variable.stealth_threshold

# Builders
actions.build=shuriken_storm,if=spell_targets.shuriken_storm>=2
actions.build+=/gloomblade
actions.build+=/backstab

# Cooldowns
actions.cds=potion,name=old_war,if=buff.bloodlust.react|target.time_to_die<=25|buff.shadow_blades.up
actions.cds+=/use_item,slot=finger2,if=(buff.shadow_blades.up&stealthed.rogue)|target.time_to_die<20
actions.cds+=/blood_fury,if=stealthed.rogue
actions.cds+=/berserking,if=stealthed.rogue
actions.cds+=/arcane_torrent,if=stealthed.rogue&energy.deficit>70
actions.cds+=/shadow_blades,if=combo_points<=2|(equipped.denial_of_the_halfgiants&combo_points>=1)
actions.cds+=/goremaws_bite,if=!stealthed.all&cooldown.shadow_dance.charges_fractional<=2.45&((combo_points.deficit>=4-(time<10)*2&energy.deficit>50+talent.vigor.enabled*25-(time>=10)*15)|target.time_to_die<8)
actions.cds+=/marked_for_death,target_if=min:target.time_to_die,if=target.time_to_die<combo_points.deficit|(raid_event.adds.in>40&combo_points.deficit>=4+talent.deeper_strategem.enabled+talent.anticipation.enabled)

# Finishers
actions.finish=enveloping_shadows,if=buff.enveloping_shadows.remains<target.time_to_die&buff.enveloping_shadows.remains<=combo_points*1.8
actions.finish+=/death_from_above,if=spell_targets.death_from_above>=6
actions.finish+=/nightblade,cycle_targets=1,if=target.time_to_die>8&((refreshable&(!finality|buff.finality_nightblade.up))|remains<tick_time)
actions.finish+=/death_from_above
actions.finish+=/eviscerate

# Stealth Action List Starter
actions.stealth_als=call_action_list,name=stealth_cds,if=energy.deficit<=variable.stealth_threshold&(!equipped.shadow_satyrs_walk|cooldown.shadow_dance.charges_fractional>=2.45|energy.deficit>=10)
actions.stealth_als+=/call_action_list,name=stealth_cds,if=spell_targets.shuriken_storm>=5
actions.stealth_als+=/call_action_list,name=stealth_cds,if=(cooldown.shadowmeld.up&!cooldown.vanish.up&cooldown.shadow_dance.charges<=1)
actions.stealth_als+=/call_action_list,name=stealth_cds,if=target.time_to_die<12*cooldown.shadow_dance.charges_fractional*(1+equipped.shadow_satyrs_walk*0.5)

# Stealth Cooldowns
actions.stealth_cds=shadow_dance,if=charges_fractional>=2.45
actions.stealth_cds+=/vanish
actions.stealth_cds+=/sprint_offensive
actions.stealth_cds+=/shadow_dance,if=charges>=2&combo_points<=1
actions.stealth_cds+=/pool_resource,for_next=1,extra_amount=40
actions.stealth_cds+=/shadowmeld,if=energy>=40&energy.deficit>=10+variable.ssw_refund
actions.stealth_cds+=/shadow_dance,if=combo_points<=1

# Stealthed Rotation
actions.stealthed=symbols_of_death,if=(buff.symbols_of_death.remains<target.time_to_die-4&buff.symbols_of_death.remains<=buff.symbols_of_death.duration*0.3)|equipped.shadow_satyrs_walk&energy.time_to_max<0.25
actions.stealthed+=/call_action_list,name=finish,if=combo_points>=5
actions.stealthed+=/shuriken_storm,if=buff.shadowmeld.down&((combo_points.deficit>=3&spell_targets.shuriken_storm>=2+talent.premeditation.enabled+equipped.shadow_satyrs_walk)|buff.the_dreadlords_deceit.stack>=29)
actions.stealthed+=/shadowstrike

head=cowl_of_fright,id=139205,bonus_id=1805/43/1507/3337
neck=sea_fan_pendant,id=142428,bonus_id=3507/1497,enchant=mark_of_the_hidden_satyr
shoulders=steelgazer_hide_mantle,id=134154,bonus_id=3417/43/1542/3337
back=drape_of_the_manastarved,id=141543,bonus_id=1808/1487/3337,gems=200agi,enchant=200agi
chest=biornskin_vest,id=134197,bonus_id=3417/1552/3337
shirt=common_gray_shirt,id=3428
wrists=denial_of_the_halfgiants,id=137100,bonus_id=3459/3458
hands=cruel_vice_grips,id=133617,bonus_id=3510/1537/3337
waist=strand_of_whelk_shells,id=142416,bonus_id=3507/1808/1497,gems=150mastery
legs=legwraps_of_unworthy_souls,id=133616,bonus_id=3418/1532/3337
feet=shadow_satyrs_walk,id=137032,bonus_id=3459/3458
finger1=grubby_silver_ring,id=139236,bonus_id=1806/1808/1502,gems=150vers,enchant=200mastery
finger2=ring_of_collapsing_futures,id=142173,bonus_id=40/3453/1482/3336,enchant=200vers
trinket1=nightblooming_frond,id=140802,bonus_id=3519
trinket2=entwined_elemental_foci,id=140796,bonus_id=3519
main_hand=fangs_of_the_devourer,id=128476,bonus_id=743,gem_id=139267/142512/139253/0,relic_id=1806:1507:3336/3468:1492/1806:1502/0
off_hand=fangs_of_the_devourer,id=128479

# Gear Summary
# gear_ilvl=891.06
# gear_agility=20768
# gear_stamina=28183
# gear_crit_rating=5349
# gear_haste_rating=3511
# gear_mastery_rating=8343
# gear_versatility_rating=3832
# gear_avoidance_rating=419
# gear_armor=2297

Simulation & Raid Information

Iterations: 5003
Threads: 4
Confidence: 95.00%
Fight Length: 222 - 381 ( 301.3 )

Performance:

Total Events Processed: 236467950
Max Event Queue: 699
Sim Seconds: 1507304
CPU Seconds: 328.7969
Physical Seconds: 110.0533
Speed Up: 4584

Settings:

World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 5 ms ( stddev = 1 ms )

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Count Impacts Crit% Avoid% G% B% Interval Combined Duration
AD+DoS AD+DoS apply_temptation 0 0 0 0.00 0 0 5.8 0.0 0.0% 0.0% 0.0% 0.0% 43.84sec 0 301.28sec
AD+DoS AD+DoS arcane_swipe 225721 3196001 10608 6.67 77269 154498 33.5 33.5 23.5% 0.0% 0.0% 0.0% 8.98sec 3196001 301.28sec
AD+DoS AD+DoS augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.28sec
AD+DoS AD+DoS auto_attack_mh 0 3121885 10362 25.14 23640 47290 126.2 126.2 23.6% 19.0% 0.0% 0.0% 1.96sec 4589467 301.28sec
AD+DoS AD+DoS auto_attack_oh 1 1547575 5137 24.97 11818 23637 125.4 125.4 23.5% 19.1% 0.0% 0.0% 1.97sec 2275082 301.28sec
AD+DoS AD+DoS backstab 53 8514665 28262 10.54 129986 259968 52.9 52.9 23.8% 0.0% 0.0% 0.0% 5.39sec 12517364 301.28sec
AD+DoS AD+DoS collapse 234142 482365 1601 1.16 66457 132947 5.8 5.8 24.1% 0.0% 0.0% 0.0% 43.84sec 482365 301.28sec
AD+DoS AD+DoS draught_of_souls 225141 0 0 0.00 0 0 2.8 0.0 0.0% 0.0% 0.0% 0.0% 115.68sec 0 301.28sec
AD+DoS AD+DoS eviscerate 196819 46718944 155068 10.43 643529 1287773 52.4 52.4 38.6% 0.0% 0.0% 0.0% 5.66sec 68681273 301.28sec
AD+DoS AD+DoS felcrazed_rage 225777 10940848 36315 7.13 246982 493969 35.8 35.8 23.7% 0.0% 0.0% 0.0% 8.12sec 10940848 301.28sec
AD+DoS AD+DoS flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.28sec
AD+DoS AD+DoS food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.28sec
AD+DoS AD+DoS goremaws_bite 209782 0 0 0.00 0 0 4.6 0.0 0.0% 0.0% 0.0% 0.0% 63.53sec 0 301.28sec
AD+DoS AD+DoS goremaws_bite_mh 209783 1893800 6286 0.92 329005 658036 4.6 4.6 23.9% 0.0% 0.0% 0.0% 63.53sec 1893800 301.28sec
AD+DoS AD+DoS goremaws_bite_oh 209784 943110 3130 0.92 164534 328881 4.6 4.6 23.4% 0.0% 0.0% 0.0% 63.53sec 943110 301.28sec
AD+DoS AD+DoS mark_of_the_hidden_satyr 191259 2509707 8330 3.34 121029 242044 16.8 16.8 23.7% 0.0% 0.0% 0.0% 17.49sec 2509707 301.28sec
AD+DoS AD+DoS nightblade ticks -195452 32965647 109885 28.65 186184 372484 16.9 143.2 23.6% 0.0% 0.0% 0.0% 17.49sec 32965647 301.28sec
AD+DoS AD+DoS potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.28sec
AD+DoS AD+DoS potion_of_the_old_war 188028 5201651 17265 4.38 190916 381818 22.0 22.0 23.8% 0.0% 0.0% 0.0% 9.52sec 7646920 301.28sec
AD+DoS AD+DoS shadow_blades 121471 0 0 0.00 0 0 2.1 0.0 0.0% 0.0% 0.0% 0.0% 180.26sec 0 301.28sec
AD+DoS AD+DoS shadow_blade_mh 121473 2770453 9196 12.70 35160 70324 63.7 63.7 23.6% 0.0% 0.0% 0.0% 3.70sec 2770453 301.28sec
AD+DoS AD+DoS shadow_blade_offhand 121474 1385265 4598 12.70 17580 35163 63.7 63.7 23.6% 0.0% 0.0% 0.0% 3.70sec 1385265 301.28sec
AD+DoS AD+DoS shadow_dance 185313 0 0 0.00 0 0 25.8 0.0 0.0% 0.0% 0.0% 0.0% 11.58sec 0 301.28sec
AD+DoS AD+DoS shadow_nova 197800 2988724 9920 6.28 76641 153281 31.5 31.5 23.7% 0.0% 0.0% 0.0% 9.56sec 2988724 301.28sec
AD+DoS AD+DoS shadowstrike 185438 33442666 111002 20.22 246291 492596 101.5 101.5 33.8% 0.0% 0.0% 0.0% 2.92sec 49163887 301.28sec
AD+DoS AD+DoS soul_rip 220893 7585013 25176 20.10 60831 121661 100.9 100.9 23.5% 0.0% 0.0% 0.0% 2.92sec 7585013 301.28sec
AD+DoS AD+DoS sprint 2983 0 0 0.00 0 0 2.7 0.0 0.0% 0.0% 0.0% 0.0% 122.25sec 0 301.28sec
AD+DoS AD+DoS symbols_of_death 212283 0 0 0.00 0 0 13.6 0.0 0.0% 0.0% 0.0% 0.0% 23.34sec 0 301.28sec
AD+DoS AD+DoS vanish 1856 0 0 0.00 0 0 2.8 0.0 0.0% 0.0% 0.0% 0.0% 122.21sec 0 301.28sec
AD+EEF AD+EEF apply_temptation 0 0 0 0.00 0 0 5.9 0.0 0.0% 0.0% 0.0% 0.0% 43.72sec 0 301.28sec
AD+EEF AD+EEF arcane_swipe 225721 3196534 10610 6.61 77291 154571 33.2 33.2 24.5% 0.0% 0.0% 0.0% 9.12sec 3196534 301.28sec
AD+EEF AD+EEF augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.28sec
AD+EEF AD+EEF auto_attack_mh 0 3180329 10556 23.99 24991 49978 120.5 120.5 24.6% 19.0% 0.0% 0.0% 2.03sec 4675385 301.28sec
AD+EEF AD+EEF auto_attack_oh 1 1576714 5233 23.81 12494 24986 119.5 119.5 24.6% 19.0% 0.0% 0.0% 2.04sec 2317919 301.28sec
AD+EEF AD+EEF backstab 53 8807650 29234 10.24 137407 274855 51.4 51.4 24.6% 0.0% 0.0% 0.0% 5.59sec 12948080 301.28sec
AD+EEF AD+EEF collapse 234142 485733 1612 1.17 66466 132883 5.9 5.9 24.0% 0.0% 0.0% 0.0% 43.72sec 485733 301.28sec
AD+EEF AD+EEF eviscerate 196819 53041004 176052 10.70 706382 1413724 53.7 53.7 39.7% 0.0% 0.0% 0.0% 5.57sec 77975301 301.28sec
AD+EEF AD+EEF flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.28sec
AD+EEF AD+EEF food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.28sec
AD+EEF AD+EEF goremaws_bite 209782 0 0 0.00 0 0 4.6 0.0 0.0% 0.0% 0.0% 0.0% 63.65sec 0 301.28sec
AD+EEF AD+EEF goremaws_bite_mh 209783 2022144 6712 0.93 348443 696247 4.6 4.6 24.9% 0.0% 0.0% 0.0% 63.65sec 2022144 301.28sec
AD+EEF AD+EEF goremaws_bite_oh 209784 1010116 3353 0.93 174210 348253 4.6 4.6 24.8% 0.0% 0.0% 0.0% 63.65sec 1010116 301.28sec
AD+EEF AD+EEF mark_of_the_hidden_satyr 191259 2693008 8939 3.29 130455 260962 16.5 16.5 24.8% 0.0% 0.0% 0.0% 18.00sec 2693008 301.28sec
AD+EEF AD+EEF nightblade ticks -195452 36774256 122581 28.94 203996 408092 17.1 144.7 24.6% 0.0% 0.0% 0.0% 17.51sec 36774256 301.28sec
AD+EEF AD+EEF potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.28sec
AD+EEF AD+EEF potion_of_the_old_war 188028 5583145 18531 4.65 191615 383244 23.4 23.4 24.7% 0.0% 0.0% 0.0% 8.06sec 8207752 301.28sec
AD+EEF AD+EEF shadow_blades 121471 0 0 0.00 0 0 2.1 0.0 0.0% 0.0% 0.0% 0.0% 180.19sec 0 301.28sec
AD+EEF AD+EEF shadow_blade_mh 121473 3127169 10380 13.42 37210 74419 67.4 67.4 24.7% 0.0% 0.0% 0.0% 3.57sec 3127169 301.28sec
AD+EEF AD+EEF shadow_blade_offhand 121474 1564162 5192 13.42 18605 37212 67.4 67.4 24.8% 0.0% 0.0% 0.0% 3.57sec 1564162 301.28sec
AD+EEF AD+EEF shadow_dance 185313 0 0 0.00 0 0 26.4 0.0 0.0% 0.0% 0.0% 0.0% 11.46sec 0 301.28sec
AD+EEF AD+EEF shadow_nova 197800 3327600 11045 6.44 82591 165178 32.3 32.3 24.7% 0.0% 0.0% 0.0% 9.53sec 3327600 301.28sec
AD+EEF AD+EEF shadowstrike 185438 36754950 121996 20.98 260253 520522 105.4 105.4 34.0% 0.0% 0.0% 0.0% 2.87sec 54033258 301.28sec
AD+EEF AD+EEF soul_rip 220893 8554743 28395 20.86 65553 131106 104.8 104.8 24.6% 0.0% 0.0% 0.0% 2.85sec 8554743 301.28sec
AD+EEF AD+EEF sprint 2983 0 0 0.00 0 0 2.7 0.0 0.0% 0.0% 0.0% 0.0% 122.24sec 0 301.28sec
AD+EEF AD+EEF symbols_of_death 212283 0 0 0.00 0 0 13.3 0.0 0.0% 0.0% 0.0% 0.0% 23.84sec 0 301.28sec
AD+EEF AD+EEF vanish 1856 0 0 0.00 0 0 2.8 0.0 0.0% 0.0% 0.0% 0.0% 122.17sec 0 301.28sec
AD+NF AD+NF apply_temptation 0 0 0 0.00 0 0 5.8 0.0 0.0% 0.0% 0.0% 0.0% 42.52sec 0 301.28sec
AD+NF AD+NF arcane_swipe 225721 3141537 10427 6.54 77263 154523 32.8 32.8 23.8% 0.0% 0.0% 0.0% 9.20sec 3141537 301.28sec
AD+NF AD+NF augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.28sec
AD+NF AD+NF auto_attack_mh 0 3121428 10361 23.81 24981 49960 119.6 119.6 23.6% 19.1% 0.0% 0.0% 2.04sec 4588795 301.28sec
AD+NF AD+NF auto_attack_oh 1 1550463 5146 23.63 12490 24977 118.7 118.7 23.6% 19.0% 0.0% 0.0% 2.06sec 2279327 301.28sec
AD+NF AD+NF backstab 53 8706258 28898 10.20 137338 274716 51.2 51.2 23.7% 0.0% 0.0% 0.0% 5.61sec 12799024 301.28sec
AD+NF AD+NF collapse 234142 476535 1582 1.16 66468 132946 5.8 5.8 23.4% 0.0% 0.0% 0.0% 42.52sec 476535 301.28sec
AD+NF AD+NF eviscerate 196819 51356017 170459 10.59 696406 1393061 53.2 53.2 38.6% 0.0% 0.0% 0.0% 5.61sec 75498209 301.28sec
AD+NF AD+NF flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.28sec
AD+NF AD+NF food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.28sec
AD+NF AD+NF goremaws_bite 209782 0 0 0.00 0 0 4.7 0.0 0.0% 0.0% 0.0% 0.0% 63.50sec 0 301.28sec
AD+NF AD+NF goremaws_bite_mh 209783 2013976 6685 0.93 348356 696840 4.7 4.7 24.0% 0.0% 0.0% 0.0% 63.50sec 2013976 301.28sec
AD+NF AD+NF goremaws_bite_oh 209784 1002389 3327 0.93 174180 348480 4.7 4.7 23.5% 0.0% 0.0% 0.0% 63.50sec 1002389 301.28sec
AD+NF AD+NF mark_of_the_hidden_satyr 191259 2632097 8736 3.25 130398 260845 16.3 16.3 23.5% 0.0% 0.0% 0.0% 18.13sec 2632097 301.28sec
AD+NF AD+NF nightblade ticks -195452 35913608 119712 28.93 200917 401827 17.1 144.6 23.6% 0.0% 0.0% 0.0% 17.51sec 35913608 301.28sec
AD+NF AD+NF potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.28sec
AD+NF AD+NF potion_of_the_old_war 188028 5476055 18176 4.61 191643 383194 23.1 23.1 23.5% 0.0% 0.0% 0.0% 8.00sec 8050319 301.28sec
AD+NF AD+NF recursive_strikes 225739 11851723 39338 16.04 119037 238378 80.5 80.5 23.6% 0.0% 0.0% 0.0% 4.79sec 17423156 301.28sec
AD+NF AD+NF shadow_blades 121471 0 0 0.00 0 0 2.1 0.0 0.0% 0.0% 0.0% 0.0% 180.20sec 0 301.28sec
AD+NF AD+NF shadow_blade_mh 121473 3056365 10145 13.23 37202 74403 66.4 66.4 23.7% 0.0% 0.0% 0.0% 3.61sec 3056365 301.28sec
AD+NF AD+NF shadow_blade_offhand 121474 1528081 5072 13.23 18600 37209 66.4 66.4 23.6% 0.0% 0.0% 0.0% 3.61sec 1528081 301.28sec
AD+NF AD+NF shadow_dance 185313 0 0 0.00 0 0 26.2 0.0 0.0% 0.0% 0.0% 0.0% 11.50sec 0 301.28sec
AD+NF AD+NF shadow_nova 197800 3280027 10887 6.40 82590 165177 32.1 32.1 23.6% 0.0% 0.0% 0.0% 9.57sec 3280027 301.28sec
AD+NF AD+NF shadowstrike 185438 36222233 120228 20.81 260253 520522 104.5 104.5 33.2% 0.0% 0.0% 0.0% 2.89sec 53250114 301.28sec
AD+NF AD+NF soul_rip 220893 8423754 27960 20.70 65553 131106 103.9 103.9 23.6% 0.0% 0.0% 0.0% 2.86sec 8423754 301.28sec
AD+NF AD+NF sprint 2983 0 0 0.00 0 0 2.7 0.0 0.0% 0.0% 0.0% 0.0% 122.21sec 0 301.28sec
AD+NF AD+NF symbols_of_death 212283 0 0 0.00 0 0 13.2 0.0 0.0% 0.0% 0.0% 0.0% 23.92sec 0 301.28sec
AD+NF AD+NF vanish 1856 0 0 0.00 0 0 2.8 0.0 0.0% 0.0% 0.0% 0.0% 122.16sec 0 301.28sec
CoF+AD CoF+AD apply_temptation 0 0 0 0.00 0 0 6.7 0.0 0.0% 0.0% 0.0% 0.0% 29.69sec 0 301.28sec
CoF+AD CoF+AD arcane_swipe 225721 3141612 10428 6.52 77491 154976 32.7 32.7 23.8% 0.0% 0.0% 0.0% 9.26sec 3141612 301.28sec
CoF+AD CoF+AD augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.28sec
CoF+AD CoF+AD auto_attack_mh 0 2101566 6975 15.97 25043 50085 80.2 80.2 23.7% 19.0% 0.0% 0.0% 2.94sec 3089501 301.28sec
CoF+AD CoF+AD auto_attack_oh 1 1045654 3471 15.89 12520 25044 79.8 79.8 23.7% 19.0% 0.0% 0.0% 2.95sec 1537210 301.28sec
CoF+AD CoF+AD backstab 53 8097378 26877 9.46 137929 275833 47.5 47.5 23.5% 0.0% 0.0% 0.0% 6.05sec 11903913 301.28sec
CoF+AD CoF+AD collapse 234142 552270 1833 1.34 66627 133258 6.7 6.7 23.6% 0.0% 0.0% 0.0% 29.69sec 552270 301.28sec
CoF+AD CoF+AD eviscerate 196819 58111220 192881 11.76 709663 1418614 59.1 59.1 38.7% 0.0% 0.0% 0.0% 5.06sec 85428998 301.28sec
CoF+AD CoF+AD flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.28sec
CoF+AD CoF+AD food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.28sec
CoF+AD CoF+AD goremaws_bite 209782 0 0 0.00 0 0 4.6 0.0 0.0% 0.0% 0.0% 0.0% 64.08sec 0 301.28sec
CoF+AD CoF+AD goremaws_bite_mh 209783 1996298 6626 0.92 349453 699387 4.6 4.6 23.4% 0.0% 0.0% 0.0% 64.08sec 1996298 301.28sec
CoF+AD CoF+AD goremaws_bite_oh 209784 999767 3318 0.92 174737 349690 4.6 4.6 23.6% 0.0% 0.0% 0.0% 64.08sec 999767 301.28sec
CoF+AD CoF+AD mark_of_the_hidden_satyr 191259 2645328 8780 3.26 130784 261510 16.4 16.4 23.5% 0.0% 0.0% 0.0% 18.20sec 2645328 301.28sec
CoF+AD CoF+AD nightblade ticks -195452 36380325 121268 29.13 201969 403797 17.0 145.6 23.7% 0.0% 0.0% 0.0% 17.54sec 36380325 301.28sec
CoF+AD CoF+AD potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.28sec
CoF+AD CoF+AD potion_of_the_old_war 188028 5497049 18246 4.62 191839 383706 23.2 23.2 23.6% 0.0% 0.0% 0.0% 5.09sec 8081183 301.28sec
CoF+AD CoF+AD shadow_blades 121471 0 0 0.00 0 0 3.6 0.0 0.0% 0.0% 0.0% 0.0% 98.21sec 0 301.28sec
CoF+AD CoF+AD shadow_blade_mh 121473 4817135 15989 20.87 37149 74301 104.8 104.8 23.7% 0.0% 0.0% 0.0% 2.73sec 4817135 301.28sec
CoF+AD CoF+AD shadow_blade_offhand 121474 2407092 7990 20.87 18574 37153 104.8 104.8 23.6% 0.0% 0.0% 0.0% 2.73sec 2407092 301.28sec
CoF+AD CoF+AD shadow_dance 185313 0 0 0.00 0 0 28.2 0.0 0.0% 0.0% 0.0% 0.0% 10.72sec 0 301.28sec
CoF+AD CoF+AD shadow_nova 197800 3434329 11399 6.70 82592 165182 33.7 33.7 23.6% 0.0% 0.0% 0.0% 9.14sec 3434329 301.28sec
CoF+AD CoF+AD shadowstrike 185438 38620504 128188 22.17 260257 520525 111.3 111.3 33.3% 0.0% 0.0% 0.0% 2.71sec 56775799 301.28sec
CoF+AD CoF+AD soul_rip 220893 8972073 29780 22.04 65553 131106 110.7 110.7 23.7% 0.0% 0.0% 0.0% 2.69sec 8972073 301.28sec
CoF+AD CoF+AD sprint 2983 0 0 0.00 0 0 2.7 0.0 0.0% 0.0% 0.0% 0.0% 122.50sec 0 301.28sec
CoF+AD CoF+AD symbols_of_death 212283 0 0 0.00 0 0 14.1 0.0 0.0% 0.0% 0.0% 0.0% 22.31sec 0 301.28sec
CoF+AD CoF+AD vanish 1856 0 0 0.00 0 0 2.8 0.0 0.0% 0.0% 0.0% 0.0% 122.48sec 0 301.28sec
CoF+DoS CoF+DoS apply_temptation 0 0 0 0.00 0 0 6.8 0.0 0.0% 0.0% 0.0% 0.0% 30.79sec 0 301.28sec
CoF+DoS CoF+DoS augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.28sec
CoF+DoS CoF+DoS auto_attack_mh 0 2175325 7220 17.45 23719 47428 87.6 87.6 23.7% 19.0% 0.0% 0.0% 2.73sec 3197934 301.28sec
CoF+DoS CoF+DoS auto_attack_oh 1 1079245 3582 17.35 11856 23716 87.1 87.1 23.5% 19.1% 0.0% 0.0% 2.74sec 1586593 301.28sec
CoF+DoS CoF+DoS backstab 53 8156941 27074 10.06 130482 260912 50.5 50.5 23.8% 0.0% 0.0% 0.0% 5.65sec 11991476 301.28sec
CoF+DoS CoF+DoS collapse 234142 559642 1858 1.35 66610 133233 6.8 6.8 23.5% 0.0% 0.0% 0.0% 30.79sec 559642 301.28sec
CoF+DoS CoF+DoS draught_of_souls 225141 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 96.46sec 0 301.28sec
CoF+DoS CoF+DoS eviscerate 196819 51818045 171993 11.38 654315 1307422 57.2 57.2 38.6% 0.0% 0.0% 0.0% 5.18sec 76177435 301.28sec
CoF+DoS CoF+DoS felcrazed_rage 225777 14540316 48262 9.44 248143 496276 47.4 47.4 23.6% 0.0% 0.0% 0.0% 5.81sec 14540316 301.28sec
CoF+DoS CoF+DoS flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.28sec
CoF+DoS CoF+DoS food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.28sec
CoF+DoS CoF+DoS goremaws_bite 209782 0 0 0.00 0 0 4.6 0.0 0.0% 0.0% 0.0% 0.0% 63.96sec 0 301.28sec
CoF+DoS CoF+DoS goremaws_bite_mh 209783 1885704 6259 0.92 330187 660552 4.6 4.6 23.9% 0.0% 0.0% 0.0% 63.96sec 1885704 301.28sec
CoF+DoS CoF+DoS goremaws_bite_oh 209784 938164 3114 0.92 165125 330140 4.6 4.6 23.3% 0.0% 0.0% 0.0% 63.96sec 938164 301.28sec
CoF+DoS CoF+DoS mark_of_the_hidden_satyr 191259 2524751 8380 3.35 121342 242677 16.8 16.8 23.5% 0.0% 0.0% 0.0% 17.45sec 2524751 301.28sec
CoF+DoS CoF+DoS nightblade ticks -195452 33298621 110995 28.82 187036 374015 16.9 144.1 23.6% 0.0% 0.0% 0.0% 17.49sec 33298621 301.28sec
CoF+DoS CoF+DoS potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.28sec
CoF+DoS CoF+DoS potion_of_the_old_war 188028 5221077 17330 4.39 191261 382570 22.1 22.1 23.7% 0.0% 0.0% 0.0% 5.61sec 7675477 301.28sec
CoF+DoS CoF+DoS shadow_blades 121471 0 0 0.00 0 0 3.5 0.0 0.0% 0.0% 0.0% 0.0% 98.43sec 0 301.28sec
CoF+DoS CoF+DoS shadow_blade_mh 121473 4404511 14619 20.23 35075 70151 101.6 101.6 23.6% 0.0% 0.0% 0.0% 2.79sec 4404511 301.28sec
CoF+DoS CoF+DoS shadow_blade_offhand 121474 2201715 7308 20.23 17537 35077 101.6 101.6 23.6% 0.0% 0.0% 0.0% 2.79sec 2201715 301.28sec
CoF+DoS CoF+DoS shadow_dance 185313 0 0 0.00 0 0 27.4 0.0 0.0% 0.0% 0.0% 0.0% 10.92sec 0 301.28sec
CoF+DoS CoF+DoS shadow_nova 197800 3102115 10296 6.52 76641 153285 32.7 32.7 23.6% 0.0% 0.0% 0.0% 9.22sec 3102115 301.28sec
CoF+DoS CoF+DoS shadowstrike 185438 34793587 115486 20.99 246294 492601 105.4 105.4 34.0% 0.0% 0.0% 0.0% 2.82sec 51149868 301.28sec
CoF+DoS CoF+DoS soul_rip 220893 7881560 26160 20.86 60831 121661 104.8 104.8 23.7% 0.0% 0.0% 0.0% 2.82sec 7881560 301.28sec
CoF+DoS CoF+DoS sprint 2983 0 0 0.00 0 0 2.7 0.0 0.0% 0.0% 0.0% 0.0% 122.37sec 0 301.28sec
CoF+DoS CoF+DoS symbols_of_death 212283 0 0 0.00 0 0 14.5 0.0 0.0% 0.0% 0.0% 0.0% 21.71sec 0 301.28sec
CoF+DoS CoF+DoS vanish 1856 0 0 0.00 0 0 2.8 0.0 0.0% 0.0% 0.0% 0.0% 122.58sec 0 301.28sec
CoF+EEF CoF+EEF apply_temptation 0 0 0 0.00 0 0 6.6 0.0 0.0% 0.0% 0.0% 0.0% 29.75sec 0 301.28sec
CoF+EEF CoF+EEF augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.28sec
CoF+EEF CoF+EEF auto_attack_mh 0 2130849 7073 16.06 25050 50100 80.6 80.6 24.5% 19.0% 0.0% 0.0% 2.92sec 3132550 301.28sec
CoF+EEF CoF+EEF auto_attack_oh 1 1061172 3522 15.97 12526 25047 80.2 80.2 24.7% 19.1% 0.0% 0.0% 2.93sec 1560023 301.28sec
CoF+EEF CoF+EEF backstab 53 8190546 27186 9.49 137968 275895 47.7 47.7 24.6% 0.0% 0.0% 0.0% 6.04sec 12040878 301.28sec
CoF+EEF CoF+EEF collapse 234142 551578 1831 1.32 66621 133230 6.6 6.6 24.7% 0.0% 0.0% 0.0% 29.75sec 551578 301.28sec
CoF+EEF CoF+EEF eviscerate 196819 59813120 198530 11.86 720174 1439334 59.5 59.5 39.6% 0.0% 0.0% 0.0% 5.02sec 87930952 301.28sec
CoF+EEF CoF+EEF flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.28sec
CoF+EEF CoF+EEF food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.28sec
CoF+EEF CoF+EEF goremaws_bite 209782 0 0 0.00 0 0 4.6 0.0 0.0% 0.0% 0.0% 0.0% 64.18sec 0 301.28sec
CoF+EEF CoF+EEF goremaws_bite_mh 209783 2015855 6691 0.92 349680 699275 4.6 4.6 24.6% 0.0% 0.0% 0.0% 64.18sec 2015855 301.28sec
CoF+EEF CoF+EEF goremaws_bite_oh 209784 1011635 3358 0.92 174862 349572 4.6 4.6 25.1% 0.0% 0.0% 0.0% 64.18sec 1011635 301.28sec
CoF+EEF CoF+EEF mark_of_the_hidden_satyr 191259 2685265 8913 3.28 130837 261658 16.5 16.5 24.6% 0.0% 0.0% 0.0% 17.93sec 2685265 301.28sec
CoF+EEF CoF+EEF nightblade ticks -195452 37238408 124128 29.15 205052 409994 17.0 145.7 24.6% 0.0% 0.0% 0.0% 17.54sec 37238408 301.28sec
CoF+EEF CoF+EEF potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.28sec
CoF+EEF CoF+EEF potion_of_the_old_war 188028 5571310 18492 4.65 191883 383785 23.3 23.3 24.4% 0.0% 0.0% 0.0% 5.03sec 8190354 301.28sec
CoF+EEF CoF+EEF shadow_blades 121471 0 0 0.00 0 0 3.5 0.0 0.0% 0.0% 0.0% 0.0% 98.49sec 0 301.28sec
CoF+EEF CoF+EEF shadow_blade_mh 121473 4915989 16317 21.15 37156 74314 106.2 106.2 24.6% 0.0% 0.0% 0.0% 2.69sec 4915989 301.28sec
CoF+EEF CoF+EEF shadow_blade_offhand 121474 2458369 8160 21.15 18578 37154 106.2 106.2 24.6% 0.0% 0.0% 0.0% 2.69sec 2458369 301.28sec
CoF+EEF CoF+EEF shadow_dance 185313 0 0 0.00 0 0 28.3 0.0 0.0% 0.0% 0.0% 0.0% 10.67sec 0 301.28sec
CoF+EEF CoF+EEF shadow_nova 197800 3479942 11551 6.73 82592 165182 33.8 33.8 24.7% 0.0% 0.0% 0.0% 9.10sec 3479942 301.28sec
CoF+EEF CoF+EEF shadowstrike 185438 39062532 129655 22.30 260259 520529 112.0 112.0 34.0% 0.0% 0.0% 0.0% 2.70sec 57425623 301.28sec
CoF+EEF CoF+EEF soul_rip 220893 9095311 30189 22.17 65553 131106 111.3 111.3 24.6% 0.0% 0.0% 0.0% 2.68sec 9095311 301.28sec
CoF+EEF CoF+EEF sprint 2983 0 0 0.00 0 0 2.7 0.0 0.0% 0.0% 0.0% 0.0% 122.54sec 0 301.28sec
CoF+EEF CoF+EEF symbols_of_death 212283 0 0 0.00 0 0 14.3 0.0 0.0% 0.0% 0.0% 0.0% 22.12sec 0 301.28sec
CoF+EEF CoF+EEF vanish 1856 0 0 0.00 0 0 2.8 0.0 0.0% 0.0% 0.0% 0.0% 122.57sec 0 301.28sec
CoF+NF CoF+NF apply_temptation 0 0 0 0.00 0 0 6.9 0.0 0.0% 0.0% 0.0% 0.0% 29.80sec 0 301.28sec
CoF+NF CoF+NF augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.28sec
CoF+NF CoF+NF auto_attack_mh 0 2101137 6974 15.97 25045 50085 80.2 80.2 23.7% 19.1% 0.0% 0.0% 2.93sec 3088871 301.28sec
CoF+NF CoF+NF auto_attack_oh 1 1046669 3474 15.89 12520 25044 79.8 79.8 23.8% 19.0% 0.0% 0.0% 2.95sec 1538703 301.28sec
CoF+NF CoF+NF backstab 53 8098566 26881 9.45 137911 275805 47.5 47.5 23.7% 0.0% 0.0% 0.0% 6.04sec 11905659 301.28sec
CoF+NF CoF+NF collapse 234142 569042 1889 1.37 66606 133265 6.9 6.9 24.2% 0.0% 0.0% 0.0% 29.80sec 569042 301.28sec
CoF+NF CoF+NF eviscerate 196819 58123319 192921 11.76 709400 1419743 59.0 59.0 38.8% 0.0% 0.0% 0.0% 5.07sec 85446784 301.28sec
CoF+NF CoF+NF flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.28sec
CoF+NF CoF+NF food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.28sec
CoF+NF CoF+NF goremaws_bite 209782 0 0 0.00 0 0 4.6 0.0 0.0% 0.0% 0.0% 0.0% 64.11sec 0 301.28sec
CoF+NF CoF+NF goremaws_bite_mh 209783 2008155 6665 0.92 349677 699518 4.6 4.6 23.9% 0.0% 0.0% 0.0% 64.11sec 2008155 301.28sec
CoF+NF CoF+NF goremaws_bite_oh 209784 1000720 3322 0.92 174840 349819 4.6 4.6 23.5% 0.0% 0.0% 0.0% 64.11sec 1000720 301.28sec
CoF+NF CoF+NF mark_of_the_hidden_satyr 191259 2643708 8775 3.25 130803 261575 16.3 16.3 23.7% 0.0% 0.0% 0.0% 18.23sec 2643708 301.28sec
CoF+NF CoF+NF nightblade ticks -195452 36345062 121150 29.12 201955 403831 17.0 145.6 23.6% 0.0% 0.0% 0.0% 17.55sec 36345062 301.28sec
CoF+NF CoF+NF potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.28sec
CoF+NF CoF+NF potion_of_the_old_war 188028 5486135 18209 4.61 191834 383736 23.2 23.2 23.5% 0.0% 0.0% 0.0% 5.18sec 8065139 301.28sec
CoF+NF CoF+NF recursive_strikes 225739 12670238 42055 16.77 121830 243366 84.2 84.2 23.5% 0.0% 0.0% 0.0% 4.89sec 18626450 301.28sec
CoF+NF CoF+NF shadow_blades 121471 0 0 0.00 0 0 3.6 0.0 0.0% 0.0% 0.0% 0.0% 98.32sec 0 301.28sec
CoF+NF CoF+NF shadow_blade_mh 121473 4812988 15975 20.87 37147 74289 104.8 104.8 23.6% 0.0% 0.0% 0.0% 2.73sec 4812988 301.28sec
CoF+NF CoF+NF shadow_blade_offhand 121474 2406388 7987 20.87 18573 37145 104.8 104.8 23.6% 0.0% 0.0% 0.0% 2.73sec 2406388 301.28sec
CoF+NF CoF+NF shadow_dance 185313 0 0 0.00 0 0 28.2 0.0 0.0% 0.0% 0.0% 0.0% 10.73sec 0 301.28sec
CoF+NF CoF+NF shadow_nova 197800 3437805 11411 6.70 82592 165185 33.6 33.6 23.8% 0.0% 0.0% 0.0% 9.15sec 3437805 301.28sec
CoF+NF CoF+NF shadowstrike 185438 38591321 128091 22.17 260259 520529 111.3 111.3 33.2% 0.0% 0.0% 0.0% 2.72sec 56732898 301.28sec
CoF+NF CoF+NF soul_rip 220893 8971063 29777 22.04 65553 131106 110.7 110.7 23.7% 0.0% 0.0% 0.0% 2.70sec 8971063 301.28sec
CoF+NF CoF+NF sprint 2983 0 0 0.00 0 0 2.7 0.0 0.0% 0.0% 0.0% 0.0% 122.45sec 0 301.28sec
CoF+NF CoF+NF symbols_of_death 212283 0 0 0.00 0 0 14.1 0.0 0.0% 0.0% 0.0% 0.0% 22.43sec 0 301.28sec
CoF+NF CoF+NF vanish 1856 0 0 0.00 0 0 2.8 0.0 0.0% 0.0% 0.0% 0.0% 122.53sec 0 301.28sec
EEF+DoS EEF+DoS apply_temptation 0 0 0 0.00 0 0 5.9 0.0 0.0% 0.0% 0.0% 0.0% 43.93sec 0 301.28sec
EEF+DoS EEF+DoS augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.28sec
EEF+DoS EEF+DoS auto_attack_mh 0 3181039 10558 25.34 23648 47298 127.2 127.2 24.7% 19.0% 0.0% 0.0% 1.94sec 4676429 301.28sec
EEF+DoS EEF+DoS auto_attack_oh 1 1577749 5237 25.16 11822 23640 126.4 126.4 24.6% 19.0% 0.0% 0.0% 1.96sec 2319440 301.28sec
EEF+DoS EEF+DoS backstab 53 8626953 28634 10.59 130017 260063 53.2 53.2 24.7% 0.0% 0.0% 0.0% 5.36sec 12682438 301.28sec
EEF+DoS EEF+DoS collapse 234142 485878 1613 1.17 66480 132895 5.9 5.9 24.6% 0.0% 0.0% 0.0% 43.93sec 485878 301.28sec
EEF+DoS EEF+DoS draught_of_souls 225141 0 0 0.00 0 0 2.8 0.0 0.0% 0.0% 0.0% 0.0% 115.84sec 0 301.28sec
EEF+DoS EEF+DoS eviscerate 196819 48190577 159953 10.52 653103 1306677 52.8 52.8 39.7% 0.0% 0.0% 0.0% 5.60sec 70844713 301.28sec
EEF+DoS EEF+DoS felcrazed_rage 225777 10991611 36483 7.13 246975 493886 35.8 35.8 24.2% 0.0% 0.0% 0.0% 8.13sec 10991611 301.28sec
EEF+DoS EEF+DoS flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.28sec
EEF+DoS EEF+DoS food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.28sec
EEF+DoS EEF+DoS goremaws_bite 209782 0 0 0.00 0 0 4.6 0.0 0.0% 0.0% 0.0% 0.0% 63.64sec 0 301.28sec
EEF+DoS EEF+DoS goremaws_bite_mh 209783 1904904 6323 0.92 329364 658806 4.6 4.6 24.8% 0.0% 0.0% 0.0% 63.64sec 1904904 301.28sec
EEF+DoS EEF+DoS goremaws_bite_oh 209784 950968 3156 0.92 164694 329393 4.6 4.6 24.6% 0.0% 0.0% 0.0% 63.64sec 950968 301.28sec
EEF+DoS EEF+DoS mark_of_the_hidden_satyr 191259 2548054 8457 3.36 121057 242118 16.9 16.9 24.7% 0.0% 0.0% 0.0% 17.55sec 2548054 301.28sec
EEF+DoS EEF+DoS nightblade ticks -195452 33779089 112597 28.66 189128 378135 17.0 143.3 24.6% 0.0% 0.0% 0.0% 17.46sec 33779089 301.28sec
EEF+DoS EEF+DoS potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.28sec
EEF+DoS EEF+DoS potion_of_the_old_war 188028 5278549 17520 4.42 190915 381814 22.2 22.2 24.7% 0.0% 0.0% 0.0% 9.49sec 7759967 301.28sec
EEF+DoS EEF+DoS shadow_blades 121471 0 0 0.00 0 0 2.1 0.0 0.0% 0.0% 0.0% 0.0% 180.24sec 0 301.28sec
EEF+DoS EEF+DoS shadow_blade_mh 121473 2827000 9383 12.85 35168 70315 64.5 64.5 24.6% 0.0% 0.0% 0.0% 3.65sec 2827000 301.28sec
EEF+DoS EEF+DoS shadow_blade_offhand 121474 1414603 4695 12.85 17584 35161 64.5 64.5 24.7% 0.0% 0.0% 0.0% 3.65sec 1414603 301.28sec
EEF+DoS EEF+DoS shadow_dance 185313 0 0 0.00 0 0 25.9 0.0 0.0% 0.0% 0.0% 0.0% 11.52sec 0 301.28sec
EEF+DoS EEF+DoS shadow_nova 197800 3021152 10028 6.30 76641 153280 31.7 31.7 24.5% 0.0% 0.0% 0.0% 9.51sec 3021152 301.28sec
EEF+DoS EEF+DoS shadowstrike 185438 33869821 112420 20.35 246294 492594 102.2 102.2 34.6% 0.0% 0.0% 0.0% 2.90sec 49791845 301.28sec
EEF+DoS EEF+DoS soul_rip 220893 7698156 25552 20.23 60831 121661 101.6 101.6 24.6% 0.0% 0.0% 0.0% 2.90sec 7698156 301.28sec
EEF+DoS EEF+DoS sprint 2983 0 0 0.00 0 0 2.7 0.0 0.0% 0.0% 0.0% 0.0% 122.30sec 0 301.28sec
EEF+DoS EEF+DoS symbols_of_death 212283 0 0 0.00 0 0 13.7 0.0 0.0% 0.0% 0.0% 0.0% 23.26sec 0 301.28sec
EEF+DoS EEF+DoS vanish 1856 0 0 0.00 0 0 2.8 0.0 0.0% 0.0% 0.0% 0.0% 122.21sec 0 301.28sec
Equipped Equipped apply_temptation 0 0 0 0.00 0 0 5.8 0.0 0.0% 0.0% 0.0% 0.0% 43.29sec 0 301.28sec
Equipped Equipped augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.28sec
Equipped Equipped auto_attack_mh 0 3029437 10055 23.82 24221 48443 119.6 119.6 23.6% 19.0% 0.0% 0.0% 2.04sec 4453560 301.28sec
Equipped Equipped auto_attack_oh 1 1502581 4987 23.64 12111 24221 118.7 118.7 23.6% 19.1% 0.0% 0.0% 2.06sec 2208936 301.28sec
Equipped Equipped backstab 53 8441727 28020 10.21 133262 266492 51.3 51.3 23.6% 0.0% 0.0% 0.0% 5.60sec 12410138 301.28sec
Equipped Equipped collapse 234142 479444 1591 1.16 66469 132902 5.8 5.8 23.5% 0.0% 0.0% 0.0% 43.29sec 479444 301.28sec
Equipped Equipped eviscerate 196819 53434812 177359 10.59 724304 1449959 53.2 53.2 38.7% 0.0% 0.0% 0.0% 5.63sec 78554236 301.28sec
Equipped Equipped flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.28sec
Equipped Equipped food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.28sec
Equipped Equipped goremaws_bite 209782 0 0 0.00 0 0 4.7 0.0 0.0% 0.0% 0.0% 0.0% 63.56sec 0 301.28sec
Equipped Equipped goremaws_bite_mh 209783 1943989 6452 0.93 337638 675761 4.7 4.7 23.3% 0.0% 0.0% 0.0% 63.56sec 1943989 301.28sec
Equipped Equipped goremaws_bite_oh 209784 971121 3223 0.93 168846 337769 4.7 4.7 23.2% 0.0% 0.0% 0.0% 63.56sec 971121 301.28sec
Equipped Equipped mark_of_the_hidden_satyr 191259 2523338 8375 3.25 125163 250300 16.3 16.3 23.4% 0.0% 0.0% 0.0% 18.13sec 2523338 301.28sec
Equipped Equipped nightblade ticks -195452 37391606 124639 28.94 208975 417878 17.1 144.7 23.7% 0.0% 0.0% 0.0% 17.50sec 37391606 301.28sec
Equipped Equipped potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.28sec
Equipped Equipped potion_of_the_old_war 188028 5455375 18107 4.60 191570 383358 23.1 23.1 23.4% 0.0% 0.0% 0.0% 8.14sec 8019917 301.28sec
Equipped Equipped shadow_blades 121471 0 0 0.00 0 0 2.1 0.0 0.0% 0.0% 0.0% 0.0% 180.21sec 0 301.28sec
Equipped Equipped shadow_blade_mh 121473 2960279 9826 13.23 36073 72162 66.4 66.4 23.6% 0.0% 0.0% 0.0% 3.61sec 2960279 301.28sec
Equipped Equipped shadow_blade_offhand 121474 1481760 4918 13.23 18038 36074 66.4 66.4 23.7% 0.0% 0.0% 0.0% 3.61sec 1481760 301.28sec
Equipped Equipped shadow_dance 185313 0 0 0.00 0 0 26.2 0.0 0.0% 0.0% 0.0% 0.0% 11.51sec 0 301.28sec
Equipped Equipped shadow_nova 197800 3151079 10459 6.40 79277 158557 32.1 32.1 23.7% 0.0% 0.0% 0.0% 9.60sec 3151079 301.28sec
Equipped Equipped shadowstrike 185438 35125918 116589 20.81 252481 504978 104.5 104.5 33.1% 0.0% 0.0% 0.0% 2.89sec 51638427 301.28sec
Equipped Equipped soul_rip 220893 8090568 26854 20.69 62925 125849 103.9 103.9 23.7% 0.0% 0.0% 0.0% 2.87sec 8090568 301.28sec
Equipped Equipped sprint 2983 0 0 0.00 0 0 2.7 0.0 0.0% 0.0% 0.0% 0.0% 122.24sec 0 301.28sec
Equipped Equipped symbols_of_death 212283 0 0 0.00 0 0 13.2 0.0 0.0% 0.0% 0.0% 0.0% 24.01sec 0 301.28sec
Equipped Equipped vanish 1856 0 0 0.00 0 0 2.8 0.0 0.0% 0.0% 0.0% 0.0% 122.13sec 0 301.28sec
EsdeathSAMA EsdeathSAMA apply_temptation 0 0 0 0.00 0 0 5.9 0.0 0.0% 0.0% 0.0% 0.0% 43.53sec 0 301.28sec
EsdeathSAMA EsdeathSAMA augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.28sec
EsdeathSAMA EsdeathSAMA auto_attack_mh 0 2783990 9241 23.83 22260 44519 119.6 119.6 23.6% 19.1% 0.0% 0.0% 2.04sec 4092729 301.28sec
EsdeathSAMA EsdeathSAMA auto_attack_oh 1 1383132 4591 23.65 11129 22259 118.7 118.7 23.7% 19.0% 0.0% 0.0% 2.06sec 2033335 301.28sec
EsdeathSAMA EsdeathSAMA backstab 53 7780907 25826 10.22 122610 245197 51.3 51.3 23.7% 0.0% 0.0% 0.0% 5.61sec 11438670 301.28sec
EsdeathSAMA EsdeathSAMA collapse 234142 483015 1603 1.17 66468 132955 5.9 5.9 23.4% 0.0% 0.0% 0.0% 43.53sec 483015 301.28sec
EsdeathSAMA EsdeathSAMA eviscerate 196819 43916586 145767 10.58 596229 1191775 53.1 53.1 38.7% 0.0% 0.0% 0.0% 5.62sec 64561541 301.28sec
EsdeathSAMA EsdeathSAMA flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.28sec
EsdeathSAMA EsdeathSAMA food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.28sec
EsdeathSAMA EsdeathSAMA goremaws_bite 209782 0 0 0.00 0 0 4.7 0.0 0.0% 0.0% 0.0% 0.0% 63.41sec 0 301.28sec
EsdeathSAMA EsdeathSAMA goremaws_bite_mh 209783 1787055 5932 0.93 310950 621760 4.7 4.7 23.0% 0.0% 0.0% 0.0% 63.41sec 1787055 301.28sec
EsdeathSAMA EsdeathSAMA goremaws_bite_oh 209784 900983 2991 0.93 155488 310866 4.7 4.7 24.1% 0.0% 0.0% 0.0% 63.41sec 900983 301.28sec
EsdeathSAMA EsdeathSAMA mark_of_the_hidden_satyr 191259 2250704 7470 3.24 111627 223214 16.3 16.3 23.8% 0.0% 0.0% 0.0% 18.10sec 2250704 301.28sec
EsdeathSAMA EsdeathSAMA nightblade ticks -195452 30737378 102458 28.93 171959 343881 17.1 144.6 23.6% 0.0% 0.0% 0.0% 17.50sec 30737378 301.28sec
EsdeathSAMA EsdeathSAMA potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.28sec
EsdeathSAMA EsdeathSAMA potion_of_the_old_war 188028 5463750 18135 4.60 191575 383077 23.1 23.1 23.5% 0.0% 0.0% 0.0% 8.18sec 8032230 301.28sec
EsdeathSAMA EsdeathSAMA shadow_blades 121471 0 0 0.00 0 0 2.1 0.0 0.0% 0.0% 0.0% 0.0% 180.24sec 0 301.28sec
EsdeathSAMA EsdeathSAMA shadow_blade_mh 121473 2717034 9018 13.21 33146 66301 66.3 66.3 23.6% 0.0% 0.0% 0.0% 3.61sec 2717034 301.28sec
EsdeathSAMA EsdeathSAMA shadow_blade_offhand 121474 1360446 4516 13.21 16574 33142 66.3 66.3 23.7% 0.0% 0.0% 0.0% 3.61sec 1360446 301.28sec
EsdeathSAMA EsdeathSAMA shadow_dance 185313 0 0 0.00 0 0 26.2 0.0 0.0% 0.0% 0.0% 0.0% 11.51sec 0 301.28sec
EsdeathSAMA EsdeathSAMA shadow_nova 197800 2805441 9312 6.39 70689 141383 32.1 32.1 23.7% 0.0% 0.0% 0.0% 9.58sec 2805441 301.28sec
EsdeathSAMA EsdeathSAMA shadowstrike 185438 32256702 107066 20.78 232323 464661 104.4 104.4 33.0% 0.0% 0.0% 0.0% 2.89sec 47420407 301.28sec
EsdeathSAMA EsdeathSAMA soul_rip 220893 7204334 23912 20.67 56108 112216 103.8 103.8 23.7% 0.0% 0.0% 0.0% 2.87sec 7204334 301.28sec
EsdeathSAMA EsdeathSAMA sprint 2983 0 0 0.00 0 0 2.7 0.0 0.0% 0.0% 0.0% 0.0% 122.28sec 0 301.28sec
EsdeathSAMA EsdeathSAMA symbols_of_death 212283 0 0 0.00 0 0 13.2 0.0 0.0% 0.0% 0.0% 0.0% 23.94sec 0 301.28sec
EsdeathSAMA EsdeathSAMA vanish 1856 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 122.18sec 0 301.28sec
NF+DoS NF+DoS apply_temptation 0 0 0 0.00 0 0 5.9 0.0 0.0% 0.0% 0.0% 0.0% 43.38sec 0 301.28sec
NF+DoS NF+DoS augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.28sec
NF+DoS NF+DoS auto_attack_mh 0 3127487 10381 25.16 23644 47291 126.3 126.3 23.7% 19.0% 0.0% 0.0% 1.96sec 4597701 301.28sec
NF+DoS NF+DoS auto_attack_oh 1 1551629 5150 24.99 11818 23641 125.5 125.5 23.6% 19.0% 0.0% 0.0% 1.97sec 2281041 301.28sec
NF+DoS NF+DoS backstab 53 8492474 28188 10.53 129985 259936 52.9 52.9 23.6% 0.0% 0.0% 0.0% 5.40sec 12484741 301.28sec
NF+DoS NF+DoS collapse 234142 486724 1616 1.18 66457 132943 5.9 5.9 23.9% 0.0% 0.0% 0.0% 43.38sec 486724 301.28sec
NF+DoS NF+DoS draught_of_souls 225141 0 0 0.00 0 0 2.8 0.0 0.0% 0.0% 0.0% 0.0% 115.80sec 0 301.28sec
NF+DoS NF+DoS eviscerate 196819 46764296 155219 10.43 643635 1287995 52.4 52.4 38.7% 0.0% 0.0% 0.0% 5.66sec 68747945 301.28sec
NF+DoS NF+DoS felcrazed_rage 225777 10935427 36297 7.14 246936 493873 35.8 35.8 23.6% 0.0% 0.0% 0.0% 8.11sec 10935427 301.28sec
NF+DoS NF+DoS flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.28sec
NF+DoS NF+DoS food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.28sec
NF+DoS NF+DoS goremaws_bite 209782 0 0 0.00 0 0 4.6 0.0 0.0% 0.0% 0.0% 0.0% 63.51sec 0 301.28sec
NF+DoS NF+DoS goremaws_bite_mh 209783 1892100 6280 0.93 329059 657981 4.6 4.6 23.7% 0.0% 0.0% 0.0% 63.51sec 1892100 301.28sec
NF+DoS NF+DoS goremaws_bite_oh 209784 948438 3148 0.93 164548 328942 4.6 4.6 24.0% 0.0% 0.0% 0.0% 63.51sec 948438 301.28sec
NF+DoS NF+DoS mark_of_the_hidden_satyr 191259 2501694 8304 3.33 121036 242025 16.7 16.7 23.6% 0.0% 0.0% 0.0% 17.73sec 2501694 301.28sec
NF+DoS NF+DoS nightblade ticks -195452 32971782 109906 28.64 186208 372506 16.9 143.2 23.6% 0.0% 0.0% 0.0% 17.47sec 32971782 301.28sec
NF+DoS NF+DoS potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.28sec
NF+DoS NF+DoS potion_of_the_old_war 188028 5219906 17326 4.40 190895 381755 22.1 22.1 23.8% 0.0% 0.0% 0.0% 9.51sec 7673756 301.28sec
NF+DoS NF+DoS recursive_strikes 225739 12099181 40159 16.20 120215 240797 81.4 81.4 23.6% 0.0% 0.0% 0.0% 4.70sec 17786942 301.28sec
NF+DoS NF+DoS shadow_blades 121471 0 0 0.00 0 0 2.1 0.0 0.0% 0.0% 0.0% 0.0% 180.24sec 0 301.28sec
NF+DoS NF+DoS shadow_blade_mh 121473 2764893 9177 12.68 35159 70306 63.7 63.7 23.5% 0.0% 0.0% 0.0% 3.70sec 2764893 301.28sec
NF+DoS NF+DoS shadow_blade_offhand 121474 1382733 4590 12.68 17579 35154 63.7 63.7 23.6% 0.0% 0.0% 0.0% 3.70sec 1382733 301.28sec
NF+DoS NF+DoS shadow_dance 185313 0 0 0.00 0 0 25.8 0.0 0.0% 0.0% 0.0% 0.0% 11.58sec 0 301.28sec
NF+DoS NF+DoS shadow_nova 197800 2990950 9927 6.29 76640 153279 31.6 31.6 23.6% 0.0% 0.0% 0.0% 9.54sec 2990950 301.28sec
NF+DoS NF+DoS shadowstrike 185438 33450130 111027 20.23 246291 492592 101.6 101.6 33.7% 0.0% 0.0% 0.0% 2.92sec 49174860 301.28sec
NF+DoS NF+DoS soul_rip 220893 7587934 25186 20.11 60831 121661 101.0 101.0 23.5% 0.0% 0.0% 0.0% 2.92sec 7587934 301.28sec
NF+DoS NF+DoS sprint 2983 0 0 0.00 0 0 2.7 0.0 0.0% 0.0% 0.0% 0.0% 122.28sec 0 301.28sec
NF+DoS NF+DoS symbols_of_death 212283 0 0 0.00 0 0 13.6 0.0 0.0% 0.0% 0.0% 0.0% 23.43sec 0 301.28sec
NF+DoS NF+DoS vanish 1856 0 0 0.00 0 0 2.8 0.0 0.0% 0.0% 0.0% 0.0% 122.25sec 0 301.28sec
NF+EEF NF+EEF apply_temptation 0 0 0 0.00 0 0 5.8 0.0 0.0% 0.0% 0.0% 0.0% 43.15sec 0 301.28sec
NF+EEF NF+EEF augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.28sec
NF+EEF NF+EEF auto_attack_mh 0 3176932 10545 24.01 24990 49977 120.5 120.5 24.5% 19.1% 0.0% 0.0% 2.03sec 4670391 301.28sec
NF+EEF NF+EEF auto_attack_oh 1 1576898 5234 23.82 12494 24990 119.6 119.6 24.6% 19.0% 0.0% 0.0% 2.04sec 2318190 301.28sec
NF+EEF NF+EEF backstab 53 8799051 29206 10.23 137399 274854 51.4 51.4 24.6% 0.0% 0.0% 0.0% 5.60sec 12935438 301.28sec
NF+EEF NF+EEF collapse 234142 481181 1597 1.16 66480 132965 5.8 5.8 24.4% 0.0% 0.0% 0.0% 43.15sec 481181 301.28sec
NF+EEF NF+EEF eviscerate 196819 53019679 175981 10.69 706953 1415166 53.7 53.7 39.6% 0.0% 0.0% 0.0% 5.56sec 77943950 301.28sec
NF+EEF NF+EEF flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.28sec
NF+EEF NF+EEF food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.28sec
NF+EEF NF+EEF goremaws_bite 209782 0 0 0.00 0 0 4.7 0.0 0.0% 0.0% 0.0% 0.0% 63.50sec 0 301.28sec
NF+EEF NF+EEF goremaws_bite_mh 209783 2017836 6698 0.93 348346 696716 4.7 4.7 24.3% 0.0% 0.0% 0.0% 63.50sec 2017836 301.28sec
NF+EEF NF+EEF goremaws_bite_oh 209784 1009773 3352 0.93 174227 348089 4.7 4.7 24.4% 0.0% 0.0% 0.0% 63.50sec 1009773 301.28sec
NF+EEF NF+EEF mark_of_the_hidden_satyr 191259 2674445 8877 3.28 130454 260794 16.5 16.5 24.6% 0.0% 0.0% 0.0% 18.14sec 2674445 301.28sec
NF+EEF NF+EEF nightblade ticks -195452 36789238 122631 28.94 204099 408150 17.1 144.7 24.6% 0.0% 0.0% 0.0% 17.51sec 36789238 301.28sec
NF+EEF NF+EEF potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.28sec
NF+EEF NF+EEF potion_of_the_old_war 188028 5554442 18436 4.63 191601 383245 23.3 23.3 24.6% 0.0% 0.0% 0.0% 8.16sec 8165556 301.28sec
NF+EEF NF+EEF recursive_strikes 225739 12149841 40327 16.21 119629 240096 81.4 81.4 24.6% 0.0% 0.0% 0.0% 4.67sec 17861418 301.28sec
NF+EEF NF+EEF shadow_blades 121471 0 0 0.00 0 0 2.1 0.0 0.0% 0.0% 0.0% 0.0% 180.15sec 0 301.28sec
NF+EEF NF+EEF shadow_blade_mh 121473 3122639 10365 13.41 37208 74419 67.3 67.3 24.6% 0.0% 0.0% 0.0% 3.54sec 3122639 301.28sec
NF+EEF NF+EEF shadow_blade_offhand 121474 1560247 5179 13.41 18605 37202 67.3 67.3 24.6% 0.0% 0.0% 0.0% 3.54sec 1560247 301.28sec
NF+EEF NF+EEF shadow_dance 185313 0 0 0.00 0 0 26.4 0.0 0.0% 0.0% 0.0% 0.0% 11.44sec 0 301.28sec
NF+EEF NF+EEF shadow_nova 197800 3325243 11037 6.44 82589 165180 32.3 32.3 24.5% 0.0% 0.0% 0.0% 9.51sec 3325243 301.28sec
NF+EEF NF+EEF shadowstrike 185438 36723364 121891 20.98 260248 520516 105.3 105.3 34.0% 0.0% 0.0% 0.0% 2.86sec 53986823 301.28sec
NF+EEF NF+EEF soul_rip 220893 8552330 28387 20.86 65553 131106 104.7 104.7 24.6% 0.0% 0.0% 0.0% 2.85sec 8552330 301.28sec
NF+EEF NF+EEF sprint 2983 0 0 0.00 0 0 2.7 0.0 0.0% 0.0% 0.0% 0.0% 122.29sec 0 301.28sec
NF+EEF NF+EEF symbols_of_death 212283 0 0 0.00 0 0 13.3 0.0 0.0% 0.0% 0.0% 0.0% 23.75sec 0 301.28sec
NF+EEF NF+EEF vanish 1856 0 0 0.00 0 0 2.8 0.0 0.0% 0.0% 0.0% 0.0% 122.26sec 0 301.28sec

Fluffy_Pillow : 0 dps

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.00% 0.0 100.0% 100%
Talents

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Health Decade (0 - 10) 1.0 0.0 0.0sec 0.0sec 11.11% 11.11% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (0 - 10)_1:11.11%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (10 - 20) 1.0 0.0 0.0sec 0.0sec 11.08% 11.08% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (10 - 20)_1:11.08%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 10.60% 10.60% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (20 - 30)_1:10.60%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 10.54% 10.54% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (30 - 40)_1:10.54%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 10.94% 10.94% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (40 - 50)_1:10.94%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 11.05% 11.05% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (50 - 60)_1:11.05%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 11.19% 11.19% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (60 - 70)_1:11.19%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 9.33% 9.33% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (70 - 80)_1:9.33%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 7.55% 7.55% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (80 - 90)_1:7.55%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (90 - 100) 1.0 0.0 0.0sec 0.0sec 6.60% 6.60% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (90 - 100)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (90 - 100)_1:6.60%

Trigger Attempt Success

  • trigger_pct:100.00%
Constant Buffs
bleeding

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_bleeding
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bleeding_1:8.65%
Mortal Wounds

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.25

Stack Uptimes

  • mortal_wounds_1:100.00%

Spelldata details

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
Fluffy_Pillow
Resource RPS-Gain RPS-Loss
Health 0.00 6871436.82
Combat End Resource Mean Min Max
Health 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %

Deaths

death count 5424
death count pct 108.41
avg death time 301.95
min death time 222.03
max death time 381.32
dmg taken 2070516748.08

Statistics & Data Analysis

Fight Length
Sample Data Fluffy_Pillow Fight Length
Count 4999
Mean 301.28
Minimum 222.03
Maximum 381.32
Spread ( max - min ) 159.29
Range [ ( max - min ) / 2 * 100% ] 26.44%
DPS
Sample Data Fluffy_Pillow Damage Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Priority Target DPS
Sample Data Fluffy_Pillow Priority Target Damage Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
DPS(e)
Sample Data Fluffy_Pillow Damage Per Second (Effective)
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Sample Data Fluffy_Pillow Damage
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Sample Data Fluffy_Pillow Damage Taken Per Second
Count 4999
Mean 6893789.04
Minimum 6446440.65
Maximum 7441699.98
Spread ( max - min ) 995259.33
Range [ ( max - min ) / 2 * 100% ] 7.22%
Standard Deviation 170622.1636
5th Percentile 6618934.73
95th Percentile 7156866.38
( 95th Percentile - 5th Percentile ) 537931.65
Mean Distribution
Standard Deviation 2413.2031
95.00% Confidence Intervall ( 6889059.25 - 6898518.83 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 24
0.1% Error 2354
0.1 Scale Factor Error with Delta=300 248516117
0.05 Scale Factor Error with Delta=300 994064466
0.01 Scale Factor Error with Delta=300 24851611645
HPS
Sample Data Fluffy_Pillow Healing Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Fluffy_Pillow Healing Per Second (Effective)
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Fluffy_Pillow Heal
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Fluffy_Pillow Healing Taken Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Fluffy_Pillow Theck-Meloree Index
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Fluffy_PillowTheck-Meloree Index (Effective)
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Fluffy_Pillow Max Spike Value
Count 1247
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0
Agility 0 0 0
Stamina 0 0 0
Intellect 0 0 0
Spirit 0 0 0
Health 0 2480746252 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Damage / Heal Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 3474 3474 3474
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

enemy="Fluffy_Pillow"
level=113
race=humanoid
role=tank
position=front
talents=0000000
spec=unknown

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

APM

Average number of actions executed per minute.

APS

Average absorption per active player duration.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Count

Average number of times an action is executed per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

DPSE

Average damage per fight duration.

DTPS

Average damage taken per second per active player duration.

HPS

Average healing (and absorption) per active player duration.

HPSE

Average healing (and absorption) per fight duration.

HPE

Average healing (or absorb) per execution of an individual action.

HPET

Average healing (or absorb) per execute time of an individual action; the amount of healing generated, divided by the time taken to execute the action, including time spent in the GCD.

HPR

Average healing (or absorb) per resource point spent.

Impacts

Average number of impacts against a target (for attacks that hit multiple times per execute) per iteration.

Dodge%

Percentage of executes that resulted in dodges.

DPS%

Percentage of total DPS contributed by a particular action.

HPS%

Percentage of total HPS (including absorb) contributed by a particular action.

Theck-Meloree Index

Measure of damage smoothness, calculated over entire fight length. Related to max spike damage, 1k TMI is roughly equivalent to 1% of your health. TMI ignores external healing and absorbs. Lower is better.

TMI bin size

Time bin size used to calculate TMI and MSD, in seconds.

Type

Direct or Periodic damage.

Max Spike Damage Frequency

This is roughly how many spikes as large as MSD Mean you take per iteration. Calculated from TMI and MSD values.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Glance%

Percentage of executes that resulted in glancing blows.

Block%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability.

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

Miss%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Gear Amount

Amount from raw gear, before class, attunement, or buff modifiers. Amount from hybrid primary stats (i.e. Agility/Intellect) shown in parentheses.

Stats Raid Buffed

Amount after all static buffs have been accounted for. Dynamic buffs (i.e. trinkets, potions) not included.

Stats Unbuffed

Amount after class modifiers and effects, but before buff modifiers.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

Ticks Crit

Average crit tick damage.

Ticks Crit%

Percentage of ticks that resulted in critical strikes.

Ticks Hit

Average non-crit tick damage.

Ticks Miss%

Percentage of ticks that resulted in misses, dodges or parries.

Ticks Uptime%

Percentage of total time that DoT is ticking on target.

Ticks Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.

TMI Range

This is the range of TMI values containing 95.00% of the data, roughly centered on the mean.

TMI/MSD Window

Window length used to calculate TMI and MSD, in seconds.

Max Spike Damage

Maximum amount of net damage taken in any N-second period (default 6sec), expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Error

Estimator for the 95.00% confidence interval.

Range

This is the range of values containing 95.00% of the data, roughly centered on the mean.

Fight Length

Fight Length: 300.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.